Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RQ57

Protein Details
Accession I1RQ57   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKVKKELIHKAKVBasic
169-191DRDRYKKAMAKTRDRNGNKKLGRBasic
NLS Segment(s)
PositionSequence
31-62PDGPWRRKVTKVKKELIHKAKVKKAYAKIKAR
160-192REEREQKMADRDRYKKAMAKTRDRNGNKKLGRE
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
KEGG fgr:FGSG_06194  -  
Amino Acid Sequences MAAKHQNEGADTASEVKKPKHGFRVGPENLPDGPWRRKVTKVKKELIHKAKVKKAYAKIKAREQENAQPAKTSEPAQDETPVEGAGEDKQPEEEGEKMHPTRHLMLADEAKAQENSVGEPSSDGNRRRTRRPGYYEKQLGKAAQLRQEQEARQAEFQRRREEREQKMADRDRYKKAMAKTRDRNGNKKLGRESSLLLDKVRKMVAEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.3
5 0.35
6 0.43
7 0.47
8 0.53
9 0.55
10 0.6
11 0.69
12 0.64
13 0.64
14 0.58
15 0.51
16 0.44
17 0.4
18 0.36
19 0.32
20 0.34
21 0.37
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.74
30 0.76
31 0.82
32 0.83
33 0.81
34 0.79
35 0.76
36 0.75
37 0.74
38 0.74
39 0.7
40 0.67
41 0.68
42 0.68
43 0.71
44 0.72
45 0.71
46 0.72
47 0.73
48 0.67
49 0.63
50 0.58
51 0.57
52 0.55
53 0.53
54 0.44
55 0.4
56 0.38
57 0.35
58 0.32
59 0.25
60 0.2
61 0.2
62 0.22
63 0.21
64 0.24
65 0.21
66 0.2
67 0.19
68 0.15
69 0.11
70 0.09
71 0.09
72 0.07
73 0.08
74 0.08
75 0.07
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.08
82 0.1
83 0.14
84 0.14
85 0.15
86 0.16
87 0.17
88 0.17
89 0.19
90 0.17
91 0.14
92 0.16
93 0.17
94 0.16
95 0.15
96 0.14
97 0.12
98 0.12
99 0.11
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.08
107 0.09
108 0.12
109 0.17
110 0.19
111 0.26
112 0.35
113 0.39
114 0.45
115 0.53
116 0.57
117 0.61
118 0.67
119 0.69
120 0.67
121 0.73
122 0.75
123 0.69
124 0.65
125 0.58
126 0.5
127 0.43
128 0.43
129 0.36
130 0.35
131 0.36
132 0.34
133 0.35
134 0.39
135 0.35
136 0.38
137 0.39
138 0.34
139 0.34
140 0.38
141 0.43
142 0.47
143 0.52
144 0.54
145 0.52
146 0.58
147 0.63
148 0.68
149 0.67
150 0.69
151 0.71
152 0.66
153 0.73
154 0.73
155 0.72
156 0.71
157 0.69
158 0.66
159 0.64
160 0.63
161 0.59
162 0.59
163 0.6
164 0.6
165 0.66
166 0.68
167 0.73
168 0.79
169 0.81
170 0.81
171 0.79
172 0.8
173 0.74
174 0.72
175 0.71
176 0.67
177 0.64
178 0.58
179 0.53
180 0.5
181 0.52
182 0.46
183 0.4
184 0.39
185 0.36
186 0.37
187 0.36
188 0.3