Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S817

Protein Details
Accession I1S817    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-41PVPVTFKQKKERQRERGSVGHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 19, nucl 4, cyto_nucl 4, mito 2, cyto 2
Family & Domain DBs
KEGG fgr:FGSG_12992  -  
Amino Acid Sequences MQPTDSYDIPQSHETLNAIPIPVPVTFKQKKERQRERGSVGGLACLNISTGLRLHEVRLSGIFHDDLASLPWSIDADQQVESQMMIQSENSIHTLLDFCMIDGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.19
4 0.16
5 0.15
6 0.13
7 0.13
8 0.13
9 0.12
10 0.15
11 0.14
12 0.23
13 0.27
14 0.32
15 0.41
16 0.47
17 0.56
18 0.64
19 0.73
20 0.74
21 0.79
22 0.81
23 0.77
24 0.74
25 0.66
26 0.57
27 0.46
28 0.38
29 0.28
30 0.21
31 0.15
32 0.1
33 0.09
34 0.06
35 0.06
36 0.04
37 0.05
38 0.05
39 0.07
40 0.07
41 0.08
42 0.09
43 0.1
44 0.1
45 0.11
46 0.1
47 0.09
48 0.1
49 0.1
50 0.08
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.09
62 0.09
63 0.1
64 0.11
65 0.11
66 0.12
67 0.11
68 0.11
69 0.1
70 0.1
71 0.09
72 0.08
73 0.08
74 0.09
75 0.1
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.11
82 0.1
83 0.13
84 0.12