Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S542

Protein Details
Accession I1S542    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-23SEPRVRKRDDTSSKEKRKWREBasic
49-68QGKARQRKGKAKQRRGLPLTBasic
NLS Segment(s)
PositionSequence
48-64GQGKARQRKGKAKQRRG
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
KEGG fgr:FGSG_11960  -  
Amino Acid Sequences MGSEPRVRKRDDTSSKEKRKWREAVGEGDEETHPSRVNQLGQGTIKAGQGKARQRKGKAKQRRGLPLTSNHRLRRDSLGSYTEHNVSNCPTKPPWACVDGGMQQLVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.82
4 0.82
5 0.8
6 0.79
7 0.78
8 0.75
9 0.73
10 0.68
11 0.68
12 0.64
13 0.57
14 0.48
15 0.42
16 0.35
17 0.27
18 0.24
19 0.16
20 0.13
21 0.11
22 0.13
23 0.14
24 0.15
25 0.16
26 0.15
27 0.18
28 0.18
29 0.19
30 0.17
31 0.16
32 0.16
33 0.14
34 0.14
35 0.14
36 0.2
37 0.28
38 0.36
39 0.42
40 0.46
41 0.51
42 0.6
43 0.66
44 0.71
45 0.74
46 0.76
47 0.74
48 0.77
49 0.81
50 0.74
51 0.69
52 0.62
53 0.61
54 0.59
55 0.6
56 0.61
57 0.55
58 0.56
59 0.53
60 0.52
61 0.5
62 0.45
63 0.41
64 0.36
65 0.34
66 0.31
67 0.33
68 0.33
69 0.28
70 0.26
71 0.23
72 0.21
73 0.21
74 0.27
75 0.26
76 0.28
77 0.27
78 0.33
79 0.36
80 0.39
81 0.4
82 0.36
83 0.35
84 0.32
85 0.36
86 0.32
87 0.32