Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RZJ5

Protein Details
Accession I1RZJ5    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
104-128TGMTALKPRDRSKKKAKAKKKKAAABasic
NLS Segment(s)
PositionSequence
70-79GKGKRDRSKK
110-128KPRDRSKKKAKAKKKKAAA
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG fgr:FGSG_09842  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MAGSHMSHDEFFAKLGELFDHRKGSDHGSIYLSQKRFTYGQDIPQPSEEEPSPDINPGKPLPLIIKATNGKGKRDRSKKVKLSTVVNPEDLEAFYVRYADVCKTGMTALKPRDRSKKKAKAKKKKAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.15
5 0.19
6 0.22
7 0.25
8 0.24
9 0.26
10 0.27
11 0.3
12 0.32
13 0.3
14 0.28
15 0.27
16 0.3
17 0.31
18 0.37
19 0.32
20 0.28
21 0.26
22 0.27
23 0.25
24 0.24
25 0.27
26 0.23
27 0.29
28 0.36
29 0.38
30 0.36
31 0.37
32 0.37
33 0.3
34 0.3
35 0.23
36 0.17
37 0.17
38 0.18
39 0.17
40 0.17
41 0.18
42 0.15
43 0.18
44 0.16
45 0.15
46 0.13
47 0.13
48 0.12
49 0.14
50 0.17
51 0.14
52 0.19
53 0.19
54 0.21
55 0.27
56 0.27
57 0.28
58 0.33
59 0.4
60 0.45
61 0.52
62 0.59
63 0.62
64 0.71
65 0.75
66 0.75
67 0.74
68 0.68
69 0.66
70 0.64
71 0.63
72 0.55
73 0.47
74 0.41
75 0.33
76 0.3
77 0.24
78 0.18
79 0.1
80 0.09
81 0.08
82 0.08
83 0.07
84 0.07
85 0.09
86 0.09
87 0.1
88 0.1
89 0.1
90 0.11
91 0.13
92 0.16
93 0.17
94 0.24
95 0.3
96 0.37
97 0.44
98 0.51
99 0.61
100 0.65
101 0.71
102 0.75
103 0.78
104 0.81
105 0.86
106 0.9
107 0.9
108 0.94