FuNGI

I1RRT1

Protein Details

Accession

I1RRT1

Localization Confidence

Low

Confidence Score

7.7

NoLS Segment(s)

Position	Sequence	Protein Nature
408-430	AQTPTKSTKRKTTKATKATPEET	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 11, mito_nucl 9.833, cyto_nucl 8.333, mito 7.5, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR002562 3'-5'_exonuclease_dom IPR012337 RNaseH-like_sf IPR036397 RNaseH_sf
Gene Ontology	GO:0008408 F:3'-5' exonuclease activity GO:0003676 F:nucleic acid binding GO:0006139 P:nucleobase-containing compound metabolic process
KEGG	fgr:FGSG_06820 -
Pfam	View protein in Pfam PF01612 DNA_pol_A_exo1
CDD	cd06141 WRN_exo

Amino Acid Sequences

MSPTIKNRLWNPAFGIRFSPEADHQPPYPFLDINRFVHTPASSSEVVRNEEVEINEFSEDEEFERDAAEWFDQQDRLEFPMVESISEGTQVATDTDGNLVDASKQDVITTETITVAPPLTSLDYALDVDQWEAARKCKQGSQESFWSYRMYRRIQEDGEEQRVKVHYCTSKQTMESVCRRYFADEKVIGFDLEWLIRHRNTDPRVNVSLIQIASPSRVALFHVALYPKDDFVAPTFKKIMEDESVTKVGVCIKGDCTRLKNNLGIESRGVLELSHLFKLVKYSKSGELKRINKIMVNLAAQTQEVLGLPLFKGNDVRSSNWMLPLSEQQISYSASDAYVGLQLYHVLEQERLKLQPTPPRPEFVEKGLPIKFLAADDVDESDDTSESGDSEVISDVEAELEELEVELAQTPTKSTKRKTTKATKATPEETKEVHTRDHRVIVAEDHAIQYRNQEHVVRVTMSSLRAYFLWHDNEGLTPESIAVLLRTPPLKTNTVVTYILDVITSEKLPYEKTRLREEVLVHLSPQTQYSNKFRALVEAAQESEEEL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.46
2	0.46
3	0.37
4	0.36
5	0.34
6	0.32
7	0.26
8	0.32
9	0.34
10	0.34
11	0.34
12	0.36
13	0.37
14	0.37
15	0.36
16	0.29
17	0.28
18	0.34
19	0.38
20	0.37
21	0.4
22	0.37
23	0.34
24	0.37
25	0.35
26	0.28
27	0.23
28	0.26
29	0.21
30	0.22
31	0.27
32	0.27
33	0.3
34	0.29
35	0.28
36	0.25
37	0.27
38	0.27
39	0.24
40	0.21
41	0.19
42	0.19
43	0.18
44	0.16
45	0.13
46	0.12
47	0.1
48	0.12
49	0.11
50	0.11
51	0.11
52	0.11
53	0.11
54	0.12
55	0.12
56	0.11
57	0.13
58	0.16
59	0.17
60	0.17
61	0.19
62	0.19
63	0.2
64	0.21
65	0.19
66	0.17
67	0.22
68	0.22
69	0.19
70	0.18
71	0.16
72	0.14
73	0.15
74	0.14
75	0.07
76	0.08
77	0.08
78	0.07
79	0.07
80	0.07
81	0.07
82	0.08
83	0.08
84	0.08
85	0.08
86	0.07
87	0.07
88	0.08
89	0.1
90	0.1
91	0.1
92	0.1
93	0.11
94	0.14
95	0.14
96	0.14
97	0.12
98	0.12
99	0.12
100	0.12
101	0.12
102	0.09
103	0.08
104	0.07
105	0.08
106	0.08
107	0.08
108	0.09
109	0.09
110	0.09
111	0.1
112	0.1
113	0.09
114	0.08
115	0.08
116	0.09
117	0.09
118	0.12
119	0.13
120	0.17
121	0.21
122	0.23
123	0.25
124	0.27
125	0.35
126	0.4
127	0.46
128	0.49
129	0.52
130	0.55
131	0.55
132	0.52
133	0.48
134	0.39
135	0.38
136	0.38
137	0.34
138	0.34
139	0.37
140	0.41
141	0.39
142	0.42
143	0.43
144	0.42
145	0.47
146	0.43
147	0.38
148	0.36
149	0.36
150	0.34
151	0.27
152	0.28
153	0.26
154	0.28
155	0.34
156	0.36
157	0.38
158	0.37
159	0.41
160	0.38
161	0.4
162	0.44
163	0.44
164	0.4
165	0.38
166	0.38
167	0.38
168	0.38
169	0.32
170	0.33
171	0.29
172	0.28
173	0.3
174	0.3
175	0.25
176	0.21
177	0.19
178	0.12
179	0.1
180	0.1
181	0.1
182	0.12
183	0.13
184	0.15
185	0.17
186	0.23
187	0.27
188	0.34
189	0.35
190	0.38
191	0.4
192	0.39
193	0.38
194	0.31
195	0.31
196	0.23
197	0.2
198	0.15
199	0.12
200	0.12
201	0.1
202	0.09
203	0.06
204	0.06
205	0.07
206	0.08
207	0.08
208	0.08
209	0.11
210	0.11
211	0.11
212	0.13
213	0.13
214	0.11
215	0.11
216	0.1
217	0.09
218	0.1
219	0.19
220	0.16
221	0.19
222	0.2
223	0.19
224	0.2
225	0.2
226	0.21
227	0.14
228	0.17
229	0.17
230	0.19
231	0.19
232	0.18
233	0.18
234	0.15
235	0.15
236	0.14
237	0.12
238	0.1
239	0.12
240	0.17
241	0.2
242	0.22
243	0.23
244	0.27
245	0.3
246	0.32
247	0.31
248	0.28
249	0.32
250	0.31
251	0.28
252	0.23
253	0.2
254	0.18
255	0.16
256	0.14
257	0.07
258	0.07
259	0.09
260	0.1
261	0.09
262	0.09
263	0.09
264	0.09
265	0.15
266	0.18
267	0.17
268	0.17
269	0.2
270	0.26
271	0.34
272	0.36
273	0.39
274	0.44
275	0.47
276	0.5
277	0.5
278	0.45
279	0.38
280	0.38
281	0.32
282	0.26
283	0.22
284	0.18
285	0.15
286	0.15
287	0.13
288	0.12
289	0.08
290	0.06
291	0.05
292	0.05
293	0.04
294	0.04
295	0.05
296	0.06
297	0.06
298	0.06
299	0.08
300	0.08
301	0.15
302	0.16
303	0.18
304	0.2
305	0.24
306	0.24
307	0.25
308	0.25
309	0.19
310	0.18
311	0.2
312	0.2
313	0.17
314	0.17
315	0.14
316	0.15
317	0.16
318	0.15
319	0.13
320	0.1
321	0.08
322	0.08
323	0.08
324	0.07
325	0.07
326	0.07
327	0.06
328	0.06
329	0.07
330	0.07
331	0.07
332	0.07
333	0.06
334	0.09
335	0.09
336	0.13
337	0.14
338	0.14
339	0.15
340	0.19
341	0.22
342	0.29
343	0.35
344	0.41
345	0.4
346	0.43
347	0.45
348	0.47
349	0.45
350	0.42
351	0.43
352	0.35
353	0.38
354	0.36
355	0.33
356	0.27
357	0.25
358	0.21
359	0.13
360	0.13
361	0.09
362	0.08
363	0.08
364	0.09
365	0.08
366	0.08
367	0.08
368	0.07
369	0.07
370	0.06
371	0.06
372	0.05
373	0.05
374	0.06
375	0.06
376	0.05
377	0.06
378	0.06
379	0.06
380	0.06
381	0.05
382	0.05
383	0.05
384	0.05
385	0.04
386	0.04
387	0.04
388	0.03
389	0.03
390	0.03
391	0.03
392	0.03
393	0.04
394	0.05
395	0.05
396	0.05
397	0.07
398	0.13
399	0.2
400	0.27
401	0.31
402	0.41
403	0.51
404	0.59
405	0.68
406	0.73
407	0.77
408	0.81
409	0.85
410	0.83
411	0.8
412	0.78
413	0.75
414	0.68
415	0.61
416	0.53
417	0.49
418	0.45
419	0.4
420	0.4
421	0.39
422	0.4
423	0.4
424	0.43
425	0.4
426	0.36
427	0.36
428	0.31
429	0.28
430	0.24
431	0.21
432	0.18
433	0.19
434	0.17
435	0.16
436	0.19
437	0.2
438	0.21
439	0.23
440	0.23
441	0.23
442	0.27
443	0.3
444	0.26
445	0.23
446	0.23
447	0.23
448	0.23
449	0.23
450	0.19
451	0.17
452	0.15
453	0.17
454	0.18
455	0.21
456	0.24
457	0.23
458	0.23
459	0.22
460	0.23
461	0.23
462	0.22
463	0.16
464	0.12
465	0.11
466	0.1
467	0.1
468	0.09
469	0.07
470	0.07
471	0.08
472	0.12
473	0.14
474	0.15
475	0.2
476	0.24
477	0.27
478	0.27
479	0.31
480	0.3
481	0.33
482	0.33
483	0.28
484	0.27
485	0.24
486	0.23
487	0.18
488	0.15
489	0.12
490	0.13
491	0.13
492	0.1
493	0.12
494	0.13
495	0.16
496	0.21
497	0.29
498	0.33
499	0.37
500	0.46
501	0.49
502	0.51
503	0.53
504	0.5
505	0.5
506	0.5
507	0.46
508	0.37
509	0.35
510	0.34
511	0.3
512	0.3
513	0.25
514	0.23
515	0.28
516	0.36
517	0.4
518	0.41
519	0.45
520	0.42
521	0.44
522	0.45
523	0.42
524	0.39
525	0.36
526	0.33
527	0.3

I1RRT1

3D AlphaFold-predicted Structure Viewer