Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1RET8

Protein Details
Accession I1RET8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
319-341TYSYRGGKMKKTKVVKVKPVQEVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR029055  Ntn_hydrolases_N  
IPR000246  Peptidase_T2  
Gene Ontology GO:0016787  F:hydrolase activity  
KEGG fgr:FGSG_02189  -  
Pfam View protein in Pfam  
PF01112  Asparaginase_2  
CDD cd04513  Glycosylasparaginase  
Amino Acid Sequences MTPVALVLGIFSFSAFAQAGNTPGLPFVINTWGGDFTAATDAAFNSLQKSKTSAIDAVEAGGLTCERNQCDGSVGFGGSPDENCETTLDAMIMDGDSMNTGAVAALRRVKDAISVARHVLEYTSHSLLAGDQATQFAIENGFKTTNLTTKASAKKCKEWKASKCQPNYRLNVSPNPEHFCGPYRPLAKNKQTQQKTQSSHDTLSLIAITKEGSLAAGTTTNGASHKIPGRVGDGPIVGSGSYADSSIGGCGATGDGDIMLRFLPCYQALDSLSRGLSPKEAAEDAVLRMVRKYSDLKSGIVVVDRYGNHGAAASGWDFTYSYRGGKMKKTKVVKVKPVQEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.1
6 0.12
7 0.13
8 0.13
9 0.11
10 0.11
11 0.12
12 0.1
13 0.09
14 0.1
15 0.13
16 0.14
17 0.14
18 0.15
19 0.15
20 0.15
21 0.15
22 0.13
23 0.1
24 0.11
25 0.11
26 0.09
27 0.09
28 0.09
29 0.11
30 0.12
31 0.11
32 0.12
33 0.17
34 0.18
35 0.18
36 0.22
37 0.23
38 0.25
39 0.29
40 0.27
41 0.25
42 0.26
43 0.25
44 0.22
45 0.19
46 0.16
47 0.12
48 0.1
49 0.08
50 0.06
51 0.08
52 0.11
53 0.12
54 0.14
55 0.15
56 0.15
57 0.19
58 0.18
59 0.18
60 0.17
61 0.16
62 0.13
63 0.13
64 0.14
65 0.1
66 0.1
67 0.1
68 0.11
69 0.11
70 0.12
71 0.12
72 0.12
73 0.12
74 0.13
75 0.1
76 0.08
77 0.07
78 0.07
79 0.06
80 0.05
81 0.04
82 0.03
83 0.03
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.05
90 0.05
91 0.07
92 0.11
93 0.12
94 0.13
95 0.13
96 0.13
97 0.14
98 0.16
99 0.2
100 0.19
101 0.21
102 0.21
103 0.21
104 0.21
105 0.19
106 0.17
107 0.12
108 0.12
109 0.14
110 0.14
111 0.13
112 0.13
113 0.13
114 0.12
115 0.13
116 0.11
117 0.07
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.05
124 0.06
125 0.06
126 0.06
127 0.08
128 0.08
129 0.08
130 0.1
131 0.11
132 0.13
133 0.16
134 0.17
135 0.17
136 0.24
137 0.32
138 0.36
139 0.43
140 0.43
141 0.49
142 0.55
143 0.63
144 0.65
145 0.67
146 0.69
147 0.72
148 0.78
149 0.78
150 0.77
151 0.76
152 0.75
153 0.73
154 0.69
155 0.63
156 0.59
157 0.54
158 0.51
159 0.47
160 0.42
161 0.37
162 0.37
163 0.33
164 0.28
165 0.26
166 0.24
167 0.23
168 0.22
169 0.25
170 0.24
171 0.27
172 0.32
173 0.4
174 0.44
175 0.5
176 0.55
177 0.59
178 0.6
179 0.63
180 0.64
181 0.64
182 0.61
183 0.58
184 0.58
185 0.5
186 0.47
187 0.42
188 0.35
189 0.26
190 0.22
191 0.18
192 0.11
193 0.08
194 0.07
195 0.06
196 0.05
197 0.05
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.05
205 0.05
206 0.06
207 0.06
208 0.07
209 0.08
210 0.09
211 0.12
212 0.17
213 0.18
214 0.18
215 0.19
216 0.23
217 0.23
218 0.23
219 0.21
220 0.17
221 0.15
222 0.14
223 0.13
224 0.09
225 0.07
226 0.06
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.03
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.05
250 0.07
251 0.08
252 0.1
253 0.11
254 0.14
255 0.16
256 0.18
257 0.19
258 0.19
259 0.19
260 0.17
261 0.17
262 0.15
263 0.15
264 0.14
265 0.14
266 0.15
267 0.15
268 0.14
269 0.15
270 0.16
271 0.15
272 0.18
273 0.18
274 0.15
275 0.16
276 0.17
277 0.15
278 0.18
279 0.22
280 0.2
281 0.29
282 0.31
283 0.31
284 0.31
285 0.33
286 0.3
287 0.28
288 0.25
289 0.17
290 0.2
291 0.19
292 0.22
293 0.21
294 0.2
295 0.18
296 0.18
297 0.17
298 0.12
299 0.14
300 0.1
301 0.09
302 0.09
303 0.1
304 0.09
305 0.1
306 0.14
307 0.13
308 0.14
309 0.19
310 0.24
311 0.28
312 0.38
313 0.48
314 0.53
315 0.61
316 0.68
317 0.72
318 0.78
319 0.84
320 0.85
321 0.85