Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S1K6

Protein Details
Accession I1S1K6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-35RTSPSKGTRASKKKSLSKQYGGIHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, E.R. 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006370  HB_polyprenyltransferase-like  
IPR039653  Prenyltransferase  
IPR000537  UbiA_prenyltransferase  
IPR044878  UbiA_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0002083  F:4-hydroxybenzoate decaprenyltransferase activity  
GO:0047293  F:4-hydroxybenzoate nonaprenyltransferase activity  
GO:0008412  F:4-hydroxybenzoate octaprenyltransferase activity  
GO:0008299  P:isoprenoid biosynthetic process  
GO:0006744  P:ubiquinone biosynthetic process  
KEGG fgr:FGSG_10613  -  
Pfam View protein in Pfam  
PF01040  UbiA  
CDD cd13959  PT_UbiA_COQ2  
Amino Acid Sequences MSATTTIALTARTSPSKGTRASKKKSLSKQYGGIHAGSWVDVLPKSWIPYVQLSRLSPPVGLILIYFPHLFGVVHAASVQSSSISEVLYISSILAIGSFFCNNGSHAWNDLVDAPIDAKIERTKMRPIPRGAISRQAAFAFSVSQAILAAACLLPLGFETALATIPTILATLYYPFAKRHTYFAQVVLGFCLTWGVMVGSSSMGVEAPWKQESAVSLLLASNLWVILFDTVYAHQDLEDDLKVGVKSLAVLFNGRARPLLWTLFLGMCTCLYWCGVTGGLGVPYFVITVGGCAVSVGSMVALVDLKDPESCWKWFATGFWFTALSILAGLSANYVLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.37
4 0.43
5 0.48
6 0.54
7 0.61
8 0.68
9 0.73
10 0.76
11 0.8
12 0.83
13 0.85
14 0.84
15 0.8
16 0.81
17 0.76
18 0.75
19 0.67
20 0.57
21 0.46
22 0.38
23 0.31
24 0.23
25 0.18
26 0.1
27 0.1
28 0.09
29 0.1
30 0.12
31 0.14
32 0.16
33 0.17
34 0.18
35 0.19
36 0.27
37 0.31
38 0.33
39 0.36
40 0.35
41 0.37
42 0.39
43 0.37
44 0.29
45 0.25
46 0.21
47 0.16
48 0.14
49 0.11
50 0.09
51 0.08
52 0.1
53 0.1
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.12
60 0.1
61 0.1
62 0.1
63 0.1
64 0.09
65 0.1
66 0.09
67 0.04
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.11
91 0.12
92 0.11
93 0.13
94 0.14
95 0.13
96 0.13
97 0.13
98 0.11
99 0.09
100 0.09
101 0.07
102 0.07
103 0.08
104 0.07
105 0.08
106 0.09
107 0.13
108 0.15
109 0.18
110 0.24
111 0.31
112 0.39
113 0.45
114 0.46
115 0.48
116 0.52
117 0.55
118 0.49
119 0.51
120 0.44
121 0.37
122 0.36
123 0.3
124 0.24
125 0.19
126 0.17
127 0.1
128 0.08
129 0.08
130 0.06
131 0.06
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.02
141 0.02
142 0.03
143 0.04
144 0.03
145 0.03
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.03
152 0.04
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.05
160 0.06
161 0.07
162 0.08
163 0.1
164 0.14
165 0.15
166 0.19
167 0.21
168 0.25
169 0.25
170 0.26
171 0.28
172 0.24
173 0.23
174 0.19
175 0.16
176 0.11
177 0.09
178 0.08
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.03
191 0.03
192 0.05
193 0.06
194 0.08
195 0.09
196 0.09
197 0.09
198 0.1
199 0.11
200 0.13
201 0.13
202 0.1
203 0.1
204 0.1
205 0.1
206 0.09
207 0.09
208 0.05
209 0.04
210 0.04
211 0.03
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.06
218 0.07
219 0.08
220 0.07
221 0.07
222 0.07
223 0.08
224 0.09
225 0.09
226 0.08
227 0.08
228 0.1
229 0.1
230 0.1
231 0.1
232 0.07
233 0.08
234 0.09
235 0.11
236 0.1
237 0.11
238 0.11
239 0.17
240 0.18
241 0.18
242 0.17
243 0.15
244 0.17
245 0.19
246 0.2
247 0.15
248 0.15
249 0.17
250 0.17
251 0.17
252 0.14
253 0.12
254 0.11
255 0.1
256 0.09
257 0.08
258 0.08
259 0.07
260 0.07
261 0.08
262 0.08
263 0.08
264 0.09
265 0.09
266 0.1
267 0.09
268 0.08
269 0.07
270 0.07
271 0.07
272 0.06
273 0.06
274 0.04
275 0.05
276 0.06
277 0.06
278 0.05
279 0.05
280 0.05
281 0.04
282 0.04
283 0.04
284 0.03
285 0.03
286 0.03
287 0.04
288 0.04
289 0.05
290 0.07
291 0.07
292 0.08
293 0.09
294 0.1
295 0.16
296 0.2
297 0.21
298 0.21
299 0.21
300 0.23
301 0.24
302 0.25
303 0.25
304 0.26
305 0.25
306 0.26
307 0.25
308 0.23
309 0.23
310 0.21
311 0.14
312 0.1
313 0.09
314 0.07
315 0.07
316 0.07
317 0.07