Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1RGU0

Protein Details
Accession I1RGU0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-29RPPAAFRKDVRSKKAKATINHydrophilic
NLS Segment(s)
PositionSequence
22-23KK
77-82KGKSGR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012664  CHP02452  
IPR043472  Macro_dom-like  
IPR019261  PARG_cat_microbial  
KEGG fgr:FGSG_02967  -  
Pfam View protein in Pfam  
PF10021  DUF2263  
Amino Acid Sequences MGRTEPSVGRPPAAFRKDVRSKKAKATINKAIPTLLSGNPRAQQGINAAELISFQDAQISSTQSGESNKDIDQSGKKGKSGRRSPNSKSDGQSNPPATDLKPPRISVRQVDTLTAARDLLEIETPSGTKVDLKNDRARVAILNMGSPLSPGGGFLNGANSQEESLCMRTTLYPSLKDEWYRIPDLASIYTPNVLVFRDEEGEDLDKKDRFYVDCITAAMIRTPEYELDNDGVATYANKKDRELAQNKIRGVMRVAVMKKTKRLVLGAWGCGAHGNPVGEIARLWKAVLLPRQDKSKSTKERWGQLDEVVFAIKDHNMAQAFAEAFGEGLERSDDGEEEEGGEEEEIDLADVRRQELLGKIAELEKRIETVVNPKVKEGLRSILEGLGKQLPADEGDSTQDSDKDDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.49
4 0.57
5 0.65
6 0.67
7 0.67
8 0.68
9 0.74
10 0.8
11 0.78
12 0.77
13 0.78
14 0.78
15 0.78
16 0.75
17 0.66
18 0.58
19 0.49
20 0.43
21 0.37
22 0.31
23 0.28
24 0.27
25 0.3
26 0.32
27 0.33
28 0.32
29 0.29
30 0.27
31 0.26
32 0.26
33 0.23
34 0.2
35 0.19
36 0.16
37 0.16
38 0.15
39 0.12
40 0.09
41 0.08
42 0.11
43 0.11
44 0.13
45 0.14
46 0.16
47 0.15
48 0.15
49 0.16
50 0.15
51 0.17
52 0.19
53 0.19
54 0.18
55 0.18
56 0.2
57 0.2
58 0.23
59 0.25
60 0.29
61 0.36
62 0.37
63 0.39
64 0.44
65 0.5
66 0.55
67 0.61
68 0.66
69 0.66
70 0.73
71 0.76
72 0.79
73 0.79
74 0.74
75 0.66
76 0.64
77 0.6
78 0.56
79 0.58
80 0.5
81 0.45
82 0.41
83 0.4
84 0.32
85 0.36
86 0.37
87 0.36
88 0.38
89 0.39
90 0.43
91 0.48
92 0.5
93 0.47
94 0.47
95 0.47
96 0.42
97 0.42
98 0.38
99 0.34
100 0.31
101 0.26
102 0.19
103 0.12
104 0.11
105 0.11
106 0.09
107 0.09
108 0.08
109 0.08
110 0.09
111 0.09
112 0.09
113 0.08
114 0.08
115 0.1
116 0.12
117 0.2
118 0.27
119 0.33
120 0.4
121 0.43
122 0.44
123 0.41
124 0.4
125 0.32
126 0.26
127 0.24
128 0.17
129 0.14
130 0.13
131 0.12
132 0.11
133 0.1
134 0.08
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.08
143 0.08
144 0.09
145 0.09
146 0.09
147 0.09
148 0.08
149 0.09
150 0.08
151 0.09
152 0.08
153 0.08
154 0.09
155 0.09
156 0.11
157 0.17
158 0.17
159 0.18
160 0.2
161 0.24
162 0.25
163 0.25
164 0.25
165 0.24
166 0.25
167 0.25
168 0.22
169 0.19
170 0.19
171 0.19
172 0.18
173 0.13
174 0.11
175 0.09
176 0.1
177 0.09
178 0.08
179 0.07
180 0.07
181 0.07
182 0.06
183 0.07
184 0.08
185 0.08
186 0.08
187 0.09
188 0.1
189 0.1
190 0.11
191 0.12
192 0.12
193 0.12
194 0.13
195 0.13
196 0.13
197 0.15
198 0.17
199 0.17
200 0.16
201 0.16
202 0.15
203 0.15
204 0.14
205 0.12
206 0.09
207 0.08
208 0.08
209 0.08
210 0.08
211 0.09
212 0.09
213 0.09
214 0.1
215 0.09
216 0.08
217 0.08
218 0.07
219 0.06
220 0.06
221 0.07
222 0.11
223 0.15
224 0.16
225 0.16
226 0.21
227 0.27
228 0.36
229 0.38
230 0.42
231 0.45
232 0.5
233 0.5
234 0.51
235 0.45
236 0.36
237 0.34
238 0.29
239 0.23
240 0.24
241 0.25
242 0.25
243 0.31
244 0.32
245 0.34
246 0.34
247 0.35
248 0.3
249 0.31
250 0.26
251 0.3
252 0.32
253 0.29
254 0.27
255 0.25
256 0.23
257 0.21
258 0.2
259 0.12
260 0.1
261 0.09
262 0.08
263 0.09
264 0.1
265 0.09
266 0.09
267 0.11
268 0.11
269 0.11
270 0.11
271 0.1
272 0.12
273 0.17
274 0.22
275 0.27
276 0.29
277 0.32
278 0.4
279 0.4
280 0.43
281 0.45
282 0.5
283 0.52
284 0.54
285 0.61
286 0.6
287 0.67
288 0.68
289 0.66
290 0.57
291 0.51
292 0.46
293 0.37
294 0.31
295 0.23
296 0.18
297 0.12
298 0.12
299 0.09
300 0.08
301 0.08
302 0.12
303 0.12
304 0.12
305 0.13
306 0.15
307 0.15
308 0.14
309 0.13
310 0.09
311 0.08
312 0.08
313 0.08
314 0.05
315 0.05
316 0.05
317 0.05
318 0.06
319 0.07
320 0.07
321 0.08
322 0.09
323 0.09
324 0.09
325 0.1
326 0.09
327 0.09
328 0.09
329 0.07
330 0.06
331 0.06
332 0.05
333 0.05
334 0.06
335 0.06
336 0.09
337 0.09
338 0.1
339 0.11
340 0.11
341 0.13
342 0.15
343 0.19
344 0.18
345 0.17
346 0.18
347 0.22
348 0.24
349 0.24
350 0.23
351 0.2
352 0.2
353 0.2
354 0.2
355 0.17
356 0.24
357 0.3
358 0.35
359 0.35
360 0.34
361 0.4
362 0.41
363 0.43
364 0.38
365 0.37
366 0.33
367 0.34
368 0.35
369 0.32
370 0.32
371 0.28
372 0.28
373 0.25
374 0.22
375 0.2
376 0.19
377 0.16
378 0.16
379 0.18
380 0.16
381 0.13
382 0.17
383 0.19
384 0.19
385 0.2
386 0.2