Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A745

Protein Details
Accession E5A745    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-31RMQPWVWRTKKFKQDRTRVVRLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTAYLPLGRMQPWVWRTKKFKQDRTRVVRLKGSALDWHGRFKLDIYCTSVRSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.49
4 0.55
5 0.65
6 0.67
7 0.73
8 0.74
9 0.81
10 0.83
11 0.84
12 0.85
13 0.79
14 0.73
15 0.67
16 0.58
17 0.51
18 0.42
19 0.34
20 0.27
21 0.25
22 0.28
23 0.25
24 0.28
25 0.26
26 0.25
27 0.24
28 0.23
29 0.27
30 0.24
31 0.26
32 0.28
33 0.31