Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098DDS5

Protein Details
Accession A0A098DDS5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-64KADEAKERGRQKRQKKEAGRDDIPCRSKHLKKHPYINERQRCSBasic
NLS Segment(s)
PositionSequence
26-41AKERGRQKRQKKEAGR
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MIECYNPVVGIDSRVLECHFRKADEAKERGRQKRQKKEAGRDDIPCRSKHLKKHPYINERQRCSDGQTRRDAMPRDLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.19
5 0.24
6 0.25
7 0.24
8 0.27
9 0.3
10 0.37
11 0.41
12 0.44
13 0.42
14 0.49
15 0.57
16 0.61
17 0.68
18 0.68
19 0.7
20 0.76
21 0.8
22 0.81
23 0.81
24 0.84
25 0.83
26 0.82
27 0.76
28 0.69
29 0.65
30 0.62
31 0.56
32 0.46
33 0.43
34 0.43
35 0.45
36 0.49
37 0.56
38 0.59
39 0.63
40 0.72
41 0.76
42 0.78
43 0.83
44 0.85
45 0.84
46 0.79
47 0.77
48 0.71
49 0.62
50 0.59
51 0.58
52 0.55
53 0.52
54 0.55
55 0.54
56 0.53
57 0.59
58 0.56