Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RS73

Protein Details
Accession I1RS73    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-47TTLLQPASPAPPKRRRRRKNSAATPAATAHydrophilic
NLS Segment(s)
PositionSequence
28-38APPKRRRRRKN
Subcellular Location(s) nucl 17, cyto 6, mito 2
Family & Domain DBs
KEGG fgr:FGSG_06986  -  
Amino Acid Sequences MSANENPENYALFRDCLSTTLLQPASPAPPKRRRRRKNSAATPAATASTPAPNPERDAEELADFVDYLAAEIFENLPDELQTLEYRTWRDNEALQEQYSLPLTKESLSVLNLPPSVVETLTTYNLISADLYTTSHLPSSPEAFLLPIITSYITPLIEPPPATRATRADACELCARSWVPLSYHHLIPRFVHEKAVKRGWHRKEDLQNVAWLCGACHRFVHNFKTHEELARDYYTVDLLLEEEEVQRWAAWVGKLRWKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.2
5 0.17
6 0.17
7 0.24
8 0.24
9 0.21
10 0.22
11 0.23
12 0.26
13 0.32
14 0.38
15 0.4
16 0.5
17 0.61
18 0.71
19 0.8
20 0.84
21 0.87
22 0.92
23 0.93
24 0.94
25 0.94
26 0.94
27 0.9
28 0.81
29 0.73
30 0.62
31 0.52
32 0.4
33 0.3
34 0.21
35 0.18
36 0.17
37 0.17
38 0.19
39 0.19
40 0.22
41 0.24
42 0.26
43 0.24
44 0.26
45 0.24
46 0.22
47 0.21
48 0.18
49 0.15
50 0.12
51 0.09
52 0.07
53 0.05
54 0.05
55 0.04
56 0.05
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.09
71 0.11
72 0.13
73 0.15
74 0.16
75 0.17
76 0.18
77 0.19
78 0.22
79 0.25
80 0.25
81 0.24
82 0.23
83 0.22
84 0.21
85 0.19
86 0.15
87 0.11
88 0.09
89 0.1
90 0.09
91 0.09
92 0.09
93 0.09
94 0.1
95 0.12
96 0.12
97 0.13
98 0.13
99 0.12
100 0.11
101 0.11
102 0.1
103 0.07
104 0.07
105 0.06
106 0.08
107 0.08
108 0.09
109 0.08
110 0.07
111 0.07
112 0.07
113 0.06
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.08
125 0.1
126 0.1
127 0.09
128 0.09
129 0.09
130 0.09
131 0.08
132 0.07
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.06
140 0.06
141 0.07
142 0.08
143 0.09
144 0.1
145 0.1
146 0.12
147 0.14
148 0.15
149 0.16
150 0.16
151 0.19
152 0.23
153 0.24
154 0.25
155 0.23
156 0.26
157 0.29
158 0.28
159 0.24
160 0.22
161 0.2
162 0.17
163 0.18
164 0.17
165 0.13
166 0.16
167 0.23
168 0.25
169 0.28
170 0.3
171 0.31
172 0.31
173 0.31
174 0.34
175 0.31
176 0.28
177 0.32
178 0.33
179 0.38
180 0.44
181 0.5
182 0.47
183 0.51
184 0.61
185 0.62
186 0.67
187 0.64
188 0.66
189 0.68
190 0.72
191 0.71
192 0.63
193 0.6
194 0.51
195 0.46
196 0.39
197 0.29
198 0.21
199 0.2
200 0.2
201 0.16
202 0.17
203 0.2
204 0.25
205 0.3
206 0.38
207 0.39
208 0.41
209 0.42
210 0.46
211 0.45
212 0.44
213 0.42
214 0.37
215 0.34
216 0.34
217 0.32
218 0.26
219 0.25
220 0.19
221 0.17
222 0.13
223 0.08
224 0.07
225 0.07
226 0.08
227 0.08
228 0.08
229 0.09
230 0.09
231 0.1
232 0.09
233 0.09
234 0.09
235 0.13
236 0.15
237 0.23
238 0.28
239 0.36