Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1S7R1

Protein Details
Accession I1S7R1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-28HVEKAMYKRRQVKQRPLIVPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, nucl 9, mito 8, cyto 8
Family & Domain DBs
KEGG fgr:FGSG_12886  -  
Amino Acid Sequences MGGHRYDAHVEKAMYKRRQVKQRPLIVPGRSGQSVIKTQAWPVQKESHAVTDVLYRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.55
4 0.59
5 0.69
6 0.72
7 0.75
8 0.75
9 0.81
10 0.76
11 0.72
12 0.7
13 0.61
14 0.53
15 0.44
16 0.37
17 0.27
18 0.25
19 0.2
20 0.16
21 0.18
22 0.18
23 0.2
24 0.18
25 0.19
26 0.24
27 0.28
28 0.27
29 0.28
30 0.32
31 0.3
32 0.33
33 0.34
34 0.33
35 0.3
36 0.28
37 0.25