Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E0S4D3

Protein Details
Accession A0A0E0S4D3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
168-191GFATRKDRARHESKHKPTVRCPWQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016766  Tscrpt_reg_Tri6  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MIYMEAESHYESWSALPLFDRVASPDPAKDFVPDLNDYESPTFEIDLLSETYDFDNFPTYSLPTVDSTKTLYSEEPLVCFDFDFANPAIENYITTSSGLLDAVPSQLIALPTFTRPSKCPFPSCKSATVFESGRDFRRHYRQHFKRFFCRYSECPQSAQDLQEVGTKGFATRKDRARHESKHKPTVRCPWQDKEGQQCLRVFSRVDNMRDHYRRIHKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.13
5 0.14
6 0.15
7 0.15
8 0.15
9 0.18
10 0.21
11 0.21
12 0.24
13 0.25
14 0.26
15 0.26
16 0.23
17 0.21
18 0.2
19 0.23
20 0.21
21 0.21
22 0.23
23 0.22
24 0.23
25 0.22
26 0.21
27 0.17
28 0.16
29 0.14
30 0.1
31 0.1
32 0.08
33 0.09
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.08
42 0.11
43 0.1
44 0.11
45 0.11
46 0.12
47 0.12
48 0.13
49 0.14
50 0.12
51 0.15
52 0.15
53 0.14
54 0.16
55 0.16
56 0.16
57 0.16
58 0.14
59 0.13
60 0.17
61 0.16
62 0.15
63 0.15
64 0.15
65 0.14
66 0.13
67 0.13
68 0.09
69 0.08
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.07
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.04
94 0.05
95 0.05
96 0.05
97 0.06
98 0.07
99 0.09
100 0.1
101 0.11
102 0.12
103 0.18
104 0.25
105 0.28
106 0.34
107 0.39
108 0.44
109 0.51
110 0.52
111 0.52
112 0.46
113 0.45
114 0.4
115 0.37
116 0.32
117 0.25
118 0.27
119 0.24
120 0.25
121 0.26
122 0.27
123 0.28
124 0.38
125 0.44
126 0.47
127 0.56
128 0.62
129 0.71
130 0.78
131 0.79
132 0.79
133 0.79
134 0.74
135 0.69
136 0.65
137 0.59
138 0.57
139 0.6
140 0.51
141 0.46
142 0.44
143 0.43
144 0.38
145 0.34
146 0.28
147 0.19
148 0.18
149 0.2
150 0.2
151 0.15
152 0.14
153 0.13
154 0.13
155 0.16
156 0.2
157 0.23
158 0.29
159 0.38
160 0.45
161 0.52
162 0.59
163 0.64
164 0.68
165 0.73
166 0.77
167 0.77
168 0.8
169 0.81
170 0.79
171 0.79
172 0.8
173 0.8
174 0.79
175 0.76
176 0.72
177 0.72
178 0.73
179 0.7
180 0.69
181 0.69
182 0.63
183 0.61
184 0.56
185 0.54
186 0.5
187 0.47
188 0.38
189 0.31
190 0.37
191 0.39
192 0.4
193 0.41
194 0.44
195 0.52
196 0.54
197 0.55
198 0.55