Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1S4F6

Protein Details
Accession I1S4F6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-112GRYEKVRASKPKPMPKSPNNKLFKKHydrophilic
NLS Segment(s)
PositionSequence
94-112RASKPKPMPKSPNNKLFKK
Subcellular Location(s) mito 9, cyto 8.5, cyto_nucl 7, nucl 4.5, pero 4
Family & Domain DBs
KEGG fgr:FGSG_11723  -  
Amino Acid Sequences MERTELNTPGAFRGVAAVDQQTGRNYGVAGVIYHPEGNPRGFARAPMEPLSREGRQYLKRFADDDGDHRVTTWPPRDEDGDDLALYEGRYEKVRASKPKPMPKSPNNKLFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.11
5 0.12
6 0.13
7 0.14
8 0.13
9 0.14
10 0.14
11 0.13
12 0.12
13 0.11
14 0.11
15 0.1
16 0.09
17 0.08
18 0.09
19 0.09
20 0.09
21 0.09
22 0.1
23 0.12
24 0.12
25 0.13
26 0.13
27 0.15
28 0.15
29 0.17
30 0.18
31 0.18
32 0.2
33 0.21
34 0.22
35 0.19
36 0.22
37 0.25
38 0.22
39 0.21
40 0.2
41 0.22
42 0.28
43 0.3
44 0.34
45 0.32
46 0.32
47 0.33
48 0.32
49 0.31
50 0.26
51 0.25
52 0.26
53 0.25
54 0.24
55 0.23
56 0.24
57 0.2
58 0.24
59 0.28
60 0.23
61 0.23
62 0.26
63 0.28
64 0.28
65 0.29
66 0.27
67 0.22
68 0.19
69 0.18
70 0.16
71 0.14
72 0.12
73 0.1
74 0.08
75 0.08
76 0.1
77 0.11
78 0.15
79 0.23
80 0.31
81 0.4
82 0.46
83 0.55
84 0.64
85 0.73
86 0.78
87 0.8
88 0.82
89 0.82
90 0.87
91 0.86
92 0.86