Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A7N8

Protein Details
Accession E5A7N8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTRRCPRTPIPRHPRPPHEKRDIRVBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MTRRCPRTPIPRHPRPPHEKRDIRVLVNGAGFAGRQAVLEHVAAVVGGVEEWRIYTSTTKPILSYTIADTRTKRPLFPPPSTPIPESQANPLSDMYSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.9
4 0.88
5 0.89
6 0.85
7 0.77
8 0.78
9 0.72
10 0.64
11 0.58
12 0.5
13 0.41
14 0.34
15 0.31
16 0.2
17 0.15
18 0.13
19 0.09
20 0.08
21 0.05
22 0.04
23 0.05
24 0.06
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.04
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.04
42 0.07
43 0.09
44 0.15
45 0.17
46 0.17
47 0.17
48 0.18
49 0.19
50 0.18
51 0.18
52 0.15
53 0.19
54 0.21
55 0.23
56 0.25
57 0.28
58 0.36
59 0.35
60 0.34
61 0.33
62 0.41
63 0.46
64 0.49
65 0.51
66 0.48
67 0.54
68 0.57
69 0.55
70 0.47
71 0.45
72 0.44
73 0.39
74 0.4
75 0.39
76 0.35
77 0.35
78 0.32
79 0.29