Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098D679

Protein Details
Accession A0A098D679   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-31KDDLTRRRERGRRSQAAFRKRQAKSBasic
NLS Segment(s)
PositionSequence
12-27RRRERGRRSQAAFRKR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVAAEIKDDLTRRRERGRRSQAAFRKRQAKSTQALTDQNCRLRNGVQLLLDEARGDERPEMLDILRDLADAADLNIPATLSSKASTTTTKLTNTTPEDFDTFKTSLVPSQIIDVPLNLKTFPAASTTQYRLDCSVWLDPLHYLRVSIPPQDLLPYIGPGAETFAGLLFWSVMEHSQSGCLRHDVVSNVKACLGHSSVTRDIKPTFIQTMARARIEYKKTGSISQEHAVAGEDDLGLVLCKLVEDDYRSNGKDPNQWLSCVSIEKRIKRAIGDYRLGFLTLAADGQANSTLHSLLEVVLCKLYDSSVCFGDGPRWDVKVVDQLFAPLIMQTLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.72
4 0.77
5 0.79
6 0.78
7 0.83
8 0.82
9 0.86
10 0.85
11 0.83
12 0.82
13 0.74
14 0.77
15 0.73
16 0.71
17 0.66
18 0.66
19 0.64
20 0.6
21 0.65
22 0.59
23 0.61
24 0.6
25 0.6
26 0.55
27 0.49
28 0.45
29 0.4
30 0.43
31 0.39
32 0.36
33 0.31
34 0.28
35 0.3
36 0.29
37 0.27
38 0.2
39 0.16
40 0.14
41 0.13
42 0.13
43 0.11
44 0.11
45 0.12
46 0.13
47 0.14
48 0.12
49 0.13
50 0.12
51 0.14
52 0.13
53 0.11
54 0.1
55 0.09
56 0.09
57 0.07
58 0.08
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.07
65 0.09
66 0.08
67 0.07
68 0.08
69 0.08
70 0.1
71 0.12
72 0.14
73 0.15
74 0.19
75 0.21
76 0.23
77 0.25
78 0.25
79 0.29
80 0.32
81 0.32
82 0.29
83 0.28
84 0.28
85 0.27
86 0.27
87 0.25
88 0.21
89 0.17
90 0.17
91 0.16
92 0.16
93 0.17
94 0.16
95 0.11
96 0.14
97 0.15
98 0.15
99 0.15
100 0.13
101 0.13
102 0.14
103 0.15
104 0.12
105 0.1
106 0.09
107 0.09
108 0.09
109 0.11
110 0.1
111 0.12
112 0.17
113 0.19
114 0.24
115 0.24
116 0.25
117 0.23
118 0.22
119 0.21
120 0.19
121 0.18
122 0.14
123 0.14
124 0.13
125 0.13
126 0.13
127 0.14
128 0.11
129 0.1
130 0.1
131 0.15
132 0.15
133 0.16
134 0.15
135 0.14
136 0.15
137 0.15
138 0.15
139 0.11
140 0.1
141 0.09
142 0.08
143 0.08
144 0.07
145 0.06
146 0.07
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.03
155 0.02
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.04
162 0.08
163 0.09
164 0.11
165 0.11
166 0.12
167 0.12
168 0.13
169 0.14
170 0.13
171 0.16
172 0.18
173 0.18
174 0.18
175 0.18
176 0.17
177 0.16
178 0.16
179 0.14
180 0.11
181 0.11
182 0.16
183 0.2
184 0.23
185 0.23
186 0.23
187 0.22
188 0.23
189 0.23
190 0.21
191 0.18
192 0.17
193 0.18
194 0.18
195 0.25
196 0.26
197 0.26
198 0.24
199 0.24
200 0.3
201 0.32
202 0.33
203 0.28
204 0.31
205 0.32
206 0.35
207 0.36
208 0.31
209 0.33
210 0.3
211 0.29
212 0.23
213 0.22
214 0.19
215 0.17
216 0.13
217 0.09
218 0.07
219 0.05
220 0.05
221 0.05
222 0.04
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.04
229 0.06
230 0.11
231 0.13
232 0.18
233 0.22
234 0.23
235 0.25
236 0.27
237 0.29
238 0.31
239 0.33
240 0.38
241 0.35
242 0.35
243 0.35
244 0.34
245 0.32
246 0.3
247 0.28
248 0.28
249 0.34
250 0.38
251 0.43
252 0.45
253 0.45
254 0.42
255 0.48
256 0.48
257 0.48
258 0.5
259 0.45
260 0.43
261 0.41
262 0.4
263 0.32
264 0.22
265 0.16
266 0.09
267 0.09
268 0.06
269 0.06
270 0.06
271 0.07
272 0.1
273 0.09
274 0.1
275 0.11
276 0.11
277 0.1
278 0.1
279 0.1
280 0.08
281 0.1
282 0.1
283 0.11
284 0.11
285 0.11
286 0.12
287 0.11
288 0.11
289 0.11
290 0.13
291 0.15
292 0.15
293 0.16
294 0.16
295 0.17
296 0.22
297 0.23
298 0.24
299 0.24
300 0.25
301 0.24
302 0.24
303 0.26
304 0.3
305 0.28
306 0.25
307 0.22
308 0.22
309 0.22
310 0.22
311 0.19
312 0.1
313 0.09