Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S8R2

Protein Details
Accession I1S8R2   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
341-375EDTKRHTIEVRKKMKRELKKKAKRDEKAESARKSLBasic
NLS Segment(s)
PositionSequence
345-374RHTIEVRKKMKRELKKKAKRDEKAESARKS
Subcellular Location(s) cyto 19.5, cyto_nucl 14, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005811  CoA_ligase  
IPR017866  Succ-CoA_synthase_bsu_CS  
IPR005809  Succ_CoA_synthase_bsu  
IPR016102  Succinyl-CoA_synth-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0000166  F:nucleotide binding  
GO:0006099  P:tricarboxylic acid cycle  
KEGG fgr:FGSG_13240  -  
Pfam View protein in Pfam  
PF00549  Ligase_CoA  
PROSITE View protein in PROSITE  
PS01217  SUCCINYL_COA_LIG_3  
Amino Acid Sequences MLAAEVLPEDGLKSYLKGDLQPRKTVYFQEELDLHKHWHLTMTIDRKDCRPVIKIRDAKPDNNTRGAPEGELFQKNYLFDLSDTDSEFMTKTIQKIASELGLVSAARQGFQQGLIALRKIFMEAQAIFLEVDVLRQRNSKIVFANSRFCFDDDAKKKARNVYLPLWEPLMEDEAELYAETFGLVYVKMNGDIGTVVNGAGLAMATNDAICVHGGKSANFLDAGGQATNDTMKRAFKIVMDDRRVKIIFVNIYGGITRCDMIAESIIDAVNSLGHQSVPMVVRLQGTNSEEGLKLLEDANLGIHVEADFDKATKKAVELAESIPTPPNVDRPKAITRKVLHEDTKRHTIEVRKKMKRELKKKAKRDEKAESARKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.16
4 0.21
5 0.3
6 0.39
7 0.44
8 0.51
9 0.53
10 0.54
11 0.55
12 0.54
13 0.5
14 0.46
15 0.41
16 0.39
17 0.38
18 0.36
19 0.37
20 0.34
21 0.31
22 0.27
23 0.27
24 0.22
25 0.23
26 0.21
27 0.22
28 0.28
29 0.35
30 0.39
31 0.43
32 0.45
33 0.43
34 0.49
35 0.48
36 0.45
37 0.43
38 0.45
39 0.49
40 0.58
41 0.64
42 0.63
43 0.71
44 0.71
45 0.69
46 0.69
47 0.7
48 0.65
49 0.63
50 0.57
51 0.49
52 0.48
53 0.44
54 0.36
55 0.26
56 0.25
57 0.24
58 0.26
59 0.25
60 0.22
61 0.23
62 0.22
63 0.22
64 0.19
65 0.15
66 0.12
67 0.15
68 0.16
69 0.16
70 0.17
71 0.17
72 0.16
73 0.15
74 0.15
75 0.12
76 0.12
77 0.13
78 0.12
79 0.18
80 0.2
81 0.2
82 0.2
83 0.21
84 0.19
85 0.17
86 0.16
87 0.11
88 0.09
89 0.09
90 0.08
91 0.09
92 0.08
93 0.08
94 0.08
95 0.09
96 0.08
97 0.09
98 0.09
99 0.07
100 0.11
101 0.12
102 0.13
103 0.12
104 0.12
105 0.12
106 0.12
107 0.11
108 0.09
109 0.11
110 0.1
111 0.13
112 0.12
113 0.13
114 0.12
115 0.11
116 0.11
117 0.07
118 0.09
119 0.09
120 0.1
121 0.1
122 0.12
123 0.13
124 0.17
125 0.19
126 0.2
127 0.21
128 0.26
129 0.32
130 0.34
131 0.42
132 0.37
133 0.38
134 0.36
135 0.34
136 0.31
137 0.26
138 0.33
139 0.29
140 0.34
141 0.36
142 0.38
143 0.4
144 0.42
145 0.45
146 0.4
147 0.41
148 0.41
149 0.43
150 0.42
151 0.41
152 0.35
153 0.31
154 0.26
155 0.2
156 0.16
157 0.1
158 0.07
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.03
186 0.03
187 0.03
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.03
195 0.03
196 0.03
197 0.04
198 0.04
199 0.07
200 0.08
201 0.08
202 0.12
203 0.12
204 0.12
205 0.12
206 0.11
207 0.09
208 0.09
209 0.11
210 0.07
211 0.07
212 0.06
213 0.07
214 0.08
215 0.07
216 0.08
217 0.08
218 0.09
219 0.1
220 0.12
221 0.13
222 0.12
223 0.2
224 0.27
225 0.34
226 0.39
227 0.43
228 0.42
229 0.47
230 0.46
231 0.38
232 0.31
233 0.28
234 0.23
235 0.19
236 0.21
237 0.15
238 0.16
239 0.16
240 0.15
241 0.11
242 0.1
243 0.09
244 0.07
245 0.07
246 0.07
247 0.07
248 0.08
249 0.07
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.06
256 0.05
257 0.04
258 0.05
259 0.04
260 0.04
261 0.05
262 0.05
263 0.09
264 0.09
265 0.1
266 0.11
267 0.12
268 0.14
269 0.14
270 0.15
271 0.16
272 0.17
273 0.17
274 0.17
275 0.18
276 0.16
277 0.16
278 0.16
279 0.12
280 0.1
281 0.09
282 0.09
283 0.08
284 0.08
285 0.08
286 0.07
287 0.07
288 0.06
289 0.06
290 0.05
291 0.06
292 0.07
293 0.08
294 0.08
295 0.08
296 0.1
297 0.1
298 0.12
299 0.12
300 0.12
301 0.17
302 0.18
303 0.21
304 0.22
305 0.24
306 0.26
307 0.26
308 0.26
309 0.22
310 0.21
311 0.21
312 0.19
313 0.27
314 0.28
315 0.31
316 0.32
317 0.36
318 0.46
319 0.52
320 0.55
321 0.55
322 0.53
323 0.59
324 0.64
325 0.65
326 0.64
327 0.64
328 0.68
329 0.66
330 0.72
331 0.64
332 0.58
333 0.55
334 0.57
335 0.59
336 0.62
337 0.65
338 0.65
339 0.69
340 0.78
341 0.83
342 0.84
343 0.84
344 0.85
345 0.86
346 0.87
347 0.92
348 0.93
349 0.94
350 0.92
351 0.9
352 0.89
353 0.88
354 0.88
355 0.88