Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZZ62

Protein Details
Accession E4ZZ62    Localization Confidence High Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MPRPCQKRRASAAANRKPKPAAPPPIRHKARQKAIHNARRGRGHydrophilic
279-307PGQARLAPPKKQPSKKQPQGQPQSQTRPLHydrophilic
320-341LSDTWKFRKGPHKGKKLFDVPEHydrophilic
NLS Segment(s)
PositionSequence
7-47KRRASAAANRKPKPAAPPPIRHKARQKAIHNARRGRGGAHT
327-334RKGPHKGK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPRPCQKRRASAAANRKPKPAAPPPIRHKARQKAIHNARRGRGGAHTAGRASQRNQRVGENHKFQEEDFVSFSNIGSTFHMHNGSGSSKDPILLQDSDYEDGEGDTDDSDVDSDDIDVEDSDMYEAEDMMINVDVSQPSRSRVRVSTAGVRLPRAEVMFTVPRALTIYKSIRASGFPLPTLTAVRYGVQEGVSPDSVSYLSLAPSLPSGLSSLSSAMSHDLHVDVKEPLGRDYVFDFGKYSGLRFEEAPENYLRTIGGQLDVYESRHPGLKEAFDYYRPGQARLAPPKKQPSKKQPQGQPQSQTRPLLPVAPKRKGTETLSDTWKFRKGPHKGKKLFDVPENYIRTVEKIPAVVENWPGFKAALQDFNRRTGRLGRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.76
4 0.69
5 0.63
6 0.63
7 0.62
8 0.62
9 0.62
10 0.69
11 0.73
12 0.8
13 0.81
14 0.8
15 0.81
16 0.8
17 0.81
18 0.8
19 0.79
20 0.79
21 0.85
22 0.85
23 0.85
24 0.82
25 0.76
26 0.73
27 0.67
28 0.57
29 0.52
30 0.49
31 0.45
32 0.42
33 0.4
34 0.34
35 0.36
36 0.39
37 0.38
38 0.36
39 0.38
40 0.42
41 0.46
42 0.47
43 0.49
44 0.51
45 0.56
46 0.62
47 0.62
48 0.56
49 0.53
50 0.51
51 0.45
52 0.48
53 0.4
54 0.33
55 0.26
56 0.25
57 0.23
58 0.23
59 0.22
60 0.15
61 0.14
62 0.12
63 0.12
64 0.13
65 0.14
66 0.16
67 0.18
68 0.15
69 0.16
70 0.17
71 0.17
72 0.17
73 0.16
74 0.16
75 0.15
76 0.15
77 0.15
78 0.14
79 0.17
80 0.15
81 0.15
82 0.16
83 0.18
84 0.19
85 0.18
86 0.17
87 0.13
88 0.12
89 0.12
90 0.08
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.09
124 0.09
125 0.11
126 0.15
127 0.16
128 0.19
129 0.2
130 0.25
131 0.27
132 0.3
133 0.35
134 0.34
135 0.37
136 0.35
137 0.34
138 0.29
139 0.25
140 0.23
141 0.16
142 0.13
143 0.09
144 0.13
145 0.14
146 0.14
147 0.14
148 0.12
149 0.12
150 0.13
151 0.13
152 0.1
153 0.13
154 0.16
155 0.18
156 0.19
157 0.19
158 0.18
159 0.19
160 0.21
161 0.2
162 0.18
163 0.15
164 0.15
165 0.15
166 0.15
167 0.15
168 0.12
169 0.09
170 0.09
171 0.09
172 0.09
173 0.09
174 0.09
175 0.09
176 0.09
177 0.08
178 0.1
179 0.09
180 0.09
181 0.08
182 0.08
183 0.08
184 0.07
185 0.07
186 0.05
187 0.05
188 0.06
189 0.06
190 0.05
191 0.06
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.08
209 0.08
210 0.09
211 0.08
212 0.08
213 0.1
214 0.1
215 0.1
216 0.11
217 0.11
218 0.11
219 0.12
220 0.15
221 0.13
222 0.13
223 0.13
224 0.11
225 0.14
226 0.13
227 0.12
228 0.12
229 0.12
230 0.13
231 0.13
232 0.15
233 0.19
234 0.2
235 0.21
236 0.2
237 0.2
238 0.19
239 0.19
240 0.16
241 0.1
242 0.11
243 0.09
244 0.09
245 0.08
246 0.08
247 0.11
248 0.12
249 0.13
250 0.13
251 0.13
252 0.12
253 0.16
254 0.16
255 0.16
256 0.18
257 0.19
258 0.19
259 0.23
260 0.24
261 0.22
262 0.27
263 0.25
264 0.3
265 0.29
266 0.28
267 0.26
268 0.3
269 0.37
270 0.43
271 0.5
272 0.48
273 0.55
274 0.64
275 0.73
276 0.76
277 0.77
278 0.78
279 0.81
280 0.86
281 0.88
282 0.87
283 0.88
284 0.89
285 0.86
286 0.84
287 0.81
288 0.8
289 0.76
290 0.7
291 0.59
292 0.53
293 0.46
294 0.44
295 0.42
296 0.43
297 0.46
298 0.51
299 0.55
300 0.54
301 0.58
302 0.57
303 0.54
304 0.54
305 0.51
306 0.5
307 0.53
308 0.53
309 0.51
310 0.49
311 0.51
312 0.43
313 0.44
314 0.47
315 0.5
316 0.58
317 0.66
318 0.74
319 0.76
320 0.8
321 0.83
322 0.81
323 0.76
324 0.73
325 0.7
326 0.65
327 0.66
328 0.64
329 0.55
330 0.48
331 0.43
332 0.39
333 0.34
334 0.31
335 0.24
336 0.22
337 0.22
338 0.24
339 0.24
340 0.23
341 0.27
342 0.26
343 0.25
344 0.24
345 0.24
346 0.21
347 0.21
348 0.24
349 0.22
350 0.29
351 0.31
352 0.41
353 0.42
354 0.51
355 0.54
356 0.49
357 0.49