Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S7G1

Protein Details
Accession I1S7G1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-35LTCSCFSSRKPTKTQRYQVDNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 2.5, cyto_nucl 2.5, plas 2, extr 2
Family & Domain DBs
KEGG fgr:FGSG_12784  -  
Amino Acid Sequences MPDLRRLFALAKVLTCSCFSSRKPTKTQRYQVDNVRAPPGQEVQNRFAPCQHYGISPSSFDVLPDPDNFEIVDEGENSTAVTAEKEKGEQGKGQGYLGGFVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.2
5 0.25
6 0.25
7 0.33
8 0.41
9 0.47
10 0.55
11 0.62
12 0.7
13 0.75
14 0.83
15 0.82
16 0.8
17 0.8
18 0.78
19 0.77
20 0.71
21 0.62
22 0.57
23 0.47
24 0.39
25 0.35
26 0.29
27 0.26
28 0.26
29 0.28
30 0.27
31 0.33
32 0.33
33 0.31
34 0.31
35 0.27
36 0.25
37 0.23
38 0.2
39 0.15
40 0.17
41 0.19
42 0.18
43 0.15
44 0.15
45 0.14
46 0.13
47 0.12
48 0.11
49 0.1
50 0.1
51 0.1
52 0.13
53 0.12
54 0.12
55 0.12
56 0.11
57 0.1
58 0.09
59 0.09
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.05
68 0.06
69 0.08
70 0.1
71 0.11
72 0.12
73 0.15
74 0.18
75 0.21
76 0.23
77 0.25
78 0.29
79 0.29
80 0.29
81 0.28
82 0.24
83 0.23