Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S4L2

Protein Details
Accession I1S4L2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
9-30SSIPSRRTDKTRSRCCKDWHEAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
KEGG fgr:FGSG_11780  -  
Amino Acid Sequences MEFRLARGSSIPSRRTDKTRSRCCKDWHEAGETIVITVGKYDKDRQGITKSFPADSSASRDDNQFDTRDKKLLRGSGKGLSKRMSGESELASESQEGQGGSQVWRATVLGQTSMLSTIEWIGSNEQQKHGDGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.58
4 0.61
5 0.64
6 0.71
7 0.76
8 0.78
9 0.81
10 0.81
11 0.82
12 0.79
13 0.77
14 0.71
15 0.66
16 0.58
17 0.51
18 0.46
19 0.36
20 0.28
21 0.19
22 0.15
23 0.09
24 0.09
25 0.09
26 0.08
27 0.1
28 0.14
29 0.17
30 0.21
31 0.23
32 0.26
33 0.32
34 0.33
35 0.35
36 0.36
37 0.33
38 0.3
39 0.29
40 0.28
41 0.22
42 0.2
43 0.22
44 0.2
45 0.2
46 0.2
47 0.21
48 0.2
49 0.21
50 0.22
51 0.17
52 0.17
53 0.19
54 0.2
55 0.24
56 0.22
57 0.23
58 0.25
59 0.29
60 0.3
61 0.3
62 0.32
63 0.33
64 0.39
65 0.38
66 0.37
67 0.33
68 0.31
69 0.29
70 0.28
71 0.24
72 0.2
73 0.19
74 0.17
75 0.16
76 0.16
77 0.14
78 0.13
79 0.11
80 0.1
81 0.08
82 0.09
83 0.07
84 0.07
85 0.09
86 0.1
87 0.1
88 0.13
89 0.12
90 0.11
91 0.12
92 0.12
93 0.11
94 0.12
95 0.13
96 0.11
97 0.11
98 0.12
99 0.11
100 0.12
101 0.11
102 0.09
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.12
109 0.17
110 0.24
111 0.26
112 0.29
113 0.31
114 0.32