Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098D2X6

Protein Details
Accession A0A098D2X6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-76PRFGWDIRKWKNSRKKTPHRAVPVPAAHydrophilic
NLS Segment(s)
PositionSequence
58-66KWKNSRKKT
Subcellular Location(s) mito 18, cyto 5, extr 4
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MAITGKRWANLILVPKVAGVPWLTLPCYLFGSCRAVTGTSYLSYLYGLEPRFGWDIRKWKNSRKKTPHRAVPVPAASHIPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.19
5 0.17
6 0.1
7 0.09
8 0.1
9 0.12
10 0.12
11 0.12
12 0.13
13 0.13
14 0.14
15 0.13
16 0.11
17 0.12
18 0.16
19 0.15
20 0.16
21 0.15
22 0.13
23 0.13
24 0.14
25 0.13
26 0.09
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.06
33 0.09
34 0.09
35 0.09
36 0.09
37 0.11
38 0.13
39 0.13
40 0.16
41 0.18
42 0.28
43 0.35
44 0.45
45 0.47
46 0.55
47 0.66
48 0.74
49 0.79
50 0.81
51 0.85
52 0.87
53 0.93
54 0.92
55 0.91
56 0.87
57 0.82
58 0.8
59 0.74
60 0.65
61 0.56