Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RLY5

Protein Details
Accession I1RLY5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
187-225KDEPKTDSKKECRCICKCKGMFKKKSKDESKESKMKSKEBasic
NLS Segment(s)
PositionSequence
210-220KKSKDESKESK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG fgr:FGSG_04956  -  
Amino Acid Sequences MCEQKTKKYICSRCSNLIFLGDSIITECDRYRWGKRCGCLEQLDIIRCEPDLCSRCPFLPADSPLPFTGKPDVAPGSAHDVENRTRSQQSKKVPYEYVGSPALEKTRKMYLVGRVDPDQKERDDRLNRELDYWLTKELELMKIRDHSGESVQEIKEEPKEEPKHEPRDQPKDEPKEELKDNLKDETKDEPKTDSKKECRCICKCKGMFKKKSKDESKESKMKSKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.67
3 0.58
4 0.52
5 0.45
6 0.34
7 0.29
8 0.2
9 0.15
10 0.14
11 0.13
12 0.1
13 0.1
14 0.1
15 0.1
16 0.14
17 0.19
18 0.27
19 0.34
20 0.43
21 0.49
22 0.54
23 0.6
24 0.62
25 0.63
26 0.58
27 0.52
28 0.49
29 0.48
30 0.45
31 0.38
32 0.33
33 0.27
34 0.23
35 0.22
36 0.16
37 0.19
38 0.2
39 0.22
40 0.25
41 0.27
42 0.28
43 0.3
44 0.29
45 0.24
46 0.27
47 0.28
48 0.31
49 0.3
50 0.32
51 0.3
52 0.32
53 0.29
54 0.24
55 0.24
56 0.18
57 0.17
58 0.18
59 0.18
60 0.16
61 0.16
62 0.15
63 0.19
64 0.19
65 0.19
66 0.17
67 0.18
68 0.2
69 0.23
70 0.23
71 0.18
72 0.2
73 0.25
74 0.31
75 0.36
76 0.42
77 0.49
78 0.52
79 0.54
80 0.51
81 0.49
82 0.46
83 0.39
84 0.35
85 0.26
86 0.22
87 0.17
88 0.17
89 0.19
90 0.16
91 0.15
92 0.14
93 0.16
94 0.17
95 0.18
96 0.2
97 0.24
98 0.3
99 0.31
100 0.31
101 0.29
102 0.33
103 0.32
104 0.32
105 0.27
106 0.21
107 0.24
108 0.23
109 0.3
110 0.32
111 0.34
112 0.37
113 0.39
114 0.38
115 0.36
116 0.35
117 0.28
118 0.24
119 0.23
120 0.18
121 0.14
122 0.14
123 0.13
124 0.14
125 0.18
126 0.17
127 0.17
128 0.18
129 0.19
130 0.2
131 0.2
132 0.19
133 0.15
134 0.15
135 0.16
136 0.15
137 0.17
138 0.17
139 0.16
140 0.17
141 0.17
142 0.18
143 0.18
144 0.17
145 0.23
146 0.27
147 0.3
148 0.39
149 0.46
150 0.52
151 0.56
152 0.64
153 0.63
154 0.7
155 0.72
156 0.71
157 0.73
158 0.72
159 0.69
160 0.66
161 0.61
162 0.57
163 0.54
164 0.52
165 0.49
166 0.46
167 0.46
168 0.46
169 0.45
170 0.4
171 0.4
172 0.42
173 0.42
174 0.41
175 0.4
176 0.39
177 0.44
178 0.49
179 0.55
180 0.56
181 0.59
182 0.64
183 0.72
184 0.76
185 0.78
186 0.8
187 0.81
188 0.79
189 0.8
190 0.77
191 0.78
192 0.81
193 0.81
194 0.83
195 0.85
196 0.87
197 0.86
198 0.92
199 0.91
200 0.89
201 0.88
202 0.88
203 0.87
204 0.86
205 0.82
206 0.8