Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RC34

Protein Details
Accession I1RC34   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
163-195TESEPLRIKIKKKRRQRRMRQAKSKHRYTILRIBasic
NLS Segment(s)
PositionSequence
169-188RIKIKKKRRQRRMRQAKSKH
Subcellular Location(s) mito 18.5, mito_nucl 12, nucl 4.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
KEGG fgr:FGSG_01136  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MSRALFRSMLELRAPSARLLAPSSLLPIRTRAFNTTAPIIEQSFPERHPKNATNPTANQPRPLALKVSHPTPPPKPMEDSVKTLLPFLAAQPDHYITVHVHGFPYLVREGDQVRLPFRMPGVQPGDILRLNRASVLGSRDYTMKGAPHIDERVFECRATVIGTESEPLRIKIKKKRRQRRMRQAKSKHRYTILRISELNINNGEDIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.22
4 0.2
5 0.19
6 0.21
7 0.2
8 0.17
9 0.16
10 0.2
11 0.19
12 0.19
13 0.18
14 0.2
15 0.21
16 0.24
17 0.26
18 0.26
19 0.28
20 0.29
21 0.32
22 0.31
23 0.3
24 0.27
25 0.27
26 0.25
27 0.21
28 0.19
29 0.2
30 0.19
31 0.2
32 0.28
33 0.28
34 0.29
35 0.36
36 0.39
37 0.45
38 0.52
39 0.56
40 0.53
41 0.55
42 0.59
43 0.62
44 0.58
45 0.52
46 0.43
47 0.4
48 0.37
49 0.35
50 0.3
51 0.21
52 0.29
53 0.28
54 0.3
55 0.31
56 0.31
57 0.35
58 0.35
59 0.41
60 0.36
61 0.37
62 0.37
63 0.36
64 0.42
65 0.39
66 0.4
67 0.36
68 0.35
69 0.33
70 0.29
71 0.25
72 0.18
73 0.15
74 0.1
75 0.14
76 0.11
77 0.11
78 0.13
79 0.14
80 0.14
81 0.13
82 0.14
83 0.08
84 0.11
85 0.11
86 0.09
87 0.09
88 0.08
89 0.08
90 0.07
91 0.09
92 0.07
93 0.06
94 0.07
95 0.08
96 0.09
97 0.11
98 0.14
99 0.12
100 0.13
101 0.14
102 0.14
103 0.13
104 0.13
105 0.15
106 0.12
107 0.18
108 0.21
109 0.2
110 0.2
111 0.21
112 0.23
113 0.21
114 0.21
115 0.16
116 0.13
117 0.13
118 0.12
119 0.12
120 0.1
121 0.1
122 0.13
123 0.13
124 0.13
125 0.14
126 0.15
127 0.15
128 0.15
129 0.14
130 0.12
131 0.12
132 0.13
133 0.14
134 0.17
135 0.19
136 0.19
137 0.19
138 0.21
139 0.24
140 0.23
141 0.22
142 0.18
143 0.15
144 0.15
145 0.15
146 0.12
147 0.1
148 0.1
149 0.1
150 0.11
151 0.11
152 0.15
153 0.15
154 0.16
155 0.2
156 0.24
157 0.31
158 0.41
159 0.51
160 0.57
161 0.67
162 0.77
163 0.83
164 0.89
165 0.93
166 0.94
167 0.95
168 0.97
169 0.96
170 0.96
171 0.96
172 0.95
173 0.93
174 0.89
175 0.86
176 0.81
177 0.77
178 0.77
179 0.72
180 0.67
181 0.59
182 0.54
183 0.54
184 0.49
185 0.45
186 0.36
187 0.31