Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098E041

Protein Details
Accession A0A098E041    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
56-80QMWRERGTKRGRERKRERERGTNFDBasic
NLS Segment(s)
PositionSequence
58-75WRERGTKRGRERKRERER
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, mito_nucl 10.166, cyto 6
Family & Domain DBs
Amino Acid Sequences MAGTSVDEAQNYCLKRRTRDGTASAQKQQEALNRVSEYPRREEEETKVGVGKRTAQMWRERGTKRGRERKRERERGTNFDVVQVRVELQKIRDQGTQGACEVGKAPGREREKRPDDQVGNEVEEGRND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.45
4 0.5
5 0.52
6 0.58
7 0.6
8 0.63
9 0.68
10 0.68
11 0.65
12 0.6
13 0.52
14 0.46
15 0.44
16 0.39
17 0.34
18 0.3
19 0.29
20 0.28
21 0.28
22 0.32
23 0.33
24 0.3
25 0.31
26 0.32
27 0.32
28 0.34
29 0.36
30 0.36
31 0.37
32 0.35
33 0.3
34 0.3
35 0.26
36 0.25
37 0.23
38 0.22
39 0.18
40 0.2
41 0.22
42 0.23
43 0.28
44 0.3
45 0.34
46 0.38
47 0.37
48 0.41
49 0.45
50 0.5
51 0.54
52 0.6
53 0.64
54 0.67
55 0.77
56 0.81
57 0.85
58 0.87
59 0.83
60 0.83
61 0.81
62 0.77
63 0.72
64 0.66
65 0.55
66 0.5
67 0.46
68 0.36
69 0.31
70 0.24
71 0.19
72 0.15
73 0.16
74 0.13
75 0.13
76 0.17
77 0.18
78 0.21
79 0.22
80 0.23
81 0.27
82 0.29
83 0.28
84 0.24
85 0.24
86 0.2
87 0.19
88 0.18
89 0.16
90 0.17
91 0.16
92 0.19
93 0.26
94 0.34
95 0.41
96 0.47
97 0.54
98 0.57
99 0.63
100 0.67
101 0.68
102 0.64
103 0.61
104 0.6
105 0.53
106 0.49
107 0.43
108 0.38