Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S9N5

Protein Details
Accession I1S9N5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-43QLNPIACSHCRQRKRKVRRIEQPRRPGETLHydrophilic
NLS Segment(s)
PositionSequence
26-37RKRKVRRIEQPR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
KEGG fgr:FGSG_13566  -  
Amino Acid Sequences MASNDAILEQESGQLNPIACSHCRQRKRKVRRIEQPRRPGETLTNKSLQCDRNIGLPIGFITRLEARLAETEEALFRLVQSIEESEDNQVSLKPSSQRKDDRIREWDSLPLRTPEQVKSWYRNRLGQSDTPIVHDVSMDLDQQESSTHVISSGADGVEFPDDGQSNSGAEIMLPDADVEVDSTTEIHTSGVPVGSKAKDMEHRNPHLYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.17
5 0.16
6 0.17
7 0.22
8 0.3
9 0.38
10 0.48
11 0.55
12 0.64
13 0.72
14 0.82
15 0.87
16 0.88
17 0.89
18 0.9
19 0.93
20 0.93
21 0.93
22 0.92
23 0.91
24 0.87
25 0.78
26 0.69
27 0.67
28 0.67
29 0.62
30 0.57
31 0.55
32 0.48
33 0.48
34 0.53
35 0.46
36 0.38
37 0.36
38 0.31
39 0.3
40 0.32
41 0.3
42 0.23
43 0.21
44 0.18
45 0.15
46 0.15
47 0.09
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.1
54 0.12
55 0.14
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.1
62 0.07
63 0.06
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.08
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.1
80 0.14
81 0.2
82 0.23
83 0.3
84 0.35
85 0.4
86 0.5
87 0.55
88 0.55
89 0.56
90 0.57
91 0.52
92 0.48
93 0.47
94 0.38
95 0.33
96 0.29
97 0.24
98 0.2
99 0.2
100 0.21
101 0.18
102 0.19
103 0.24
104 0.26
105 0.31
106 0.36
107 0.42
108 0.42
109 0.46
110 0.46
111 0.43
112 0.45
113 0.41
114 0.4
115 0.37
116 0.35
117 0.32
118 0.3
119 0.26
120 0.21
121 0.18
122 0.13
123 0.1
124 0.1
125 0.08
126 0.07
127 0.07
128 0.07
129 0.07
130 0.08
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.08
140 0.07
141 0.06
142 0.07
143 0.07
144 0.08
145 0.07
146 0.06
147 0.07
148 0.08
149 0.09
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.07
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.07
176 0.09
177 0.11
178 0.11
179 0.12
180 0.17
181 0.17
182 0.19
183 0.19
184 0.23
185 0.29
186 0.36
187 0.45
188 0.5
189 0.57