Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W5T7

Protein Details
Accession G0W5T7   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-110FVRTSHPKRSFNKRGRNFNANKKGDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 8, cyto_nucl 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045358  Ty3_capsid  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0043227  C:membrane-bounded organelle  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG ndi:NDAI_0B01140  -  
Pfam View protein in Pfam  
PF19259  Ty3_capsid  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MRTLLPPNYFSDEAYLNKYIGGLKPELRKDLRLHNPMSLFDATEIAMRSTALTTSAPGTKPWAIDFSTPASVANNNAGSDPMEIDFVRTSHPKRSFNKRGRNFNANKKGDQSNNWRNKFREVCLANGFCLNCGKPGHTKAQCKEASNPQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.21
4 0.2
5 0.21
6 0.2
7 0.19
8 0.2
9 0.18
10 0.22
11 0.3
12 0.33
13 0.39
14 0.39
15 0.41
16 0.41
17 0.48
18 0.52
19 0.51
20 0.5
21 0.48
22 0.47
23 0.43
24 0.44
25 0.34
26 0.25
27 0.19
28 0.17
29 0.13
30 0.13
31 0.13
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.07
41 0.08
42 0.11
43 0.11
44 0.11
45 0.15
46 0.15
47 0.15
48 0.15
49 0.16
50 0.14
51 0.14
52 0.15
53 0.15
54 0.14
55 0.14
56 0.13
57 0.12
58 0.11
59 0.1
60 0.11
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.06
69 0.07
70 0.06
71 0.07
72 0.08
73 0.07
74 0.1
75 0.13
76 0.15
77 0.22
78 0.29
79 0.35
80 0.41
81 0.52
82 0.61
83 0.67
84 0.76
85 0.76
86 0.8
87 0.8
88 0.84
89 0.8
90 0.8
91 0.81
92 0.74
93 0.67
94 0.61
95 0.6
96 0.53
97 0.53
98 0.52
99 0.52
100 0.59
101 0.63
102 0.64
103 0.6
104 0.66
105 0.64
106 0.56
107 0.56
108 0.47
109 0.47
110 0.49
111 0.48
112 0.4
113 0.39
114 0.36
115 0.27
116 0.29
117 0.24
118 0.2
119 0.2
120 0.23
121 0.26
122 0.31
123 0.4
124 0.45
125 0.54
126 0.54
127 0.63
128 0.65
129 0.61
130 0.64