Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RZ77

Protein Details
Accession I1RZ77   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
160-185VGACIWRRRYLKKKDRQSHLIQKHSGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 5, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG fgr:FGSG_09703  -  
Amino Acid Sequences MADQGAAAPPVTTIVPFNNQQILPACAAACGPLYDANGACVPPQVAADAGPKAYTSCFCLDQRVAAFKTATQGVCDDACGAEGLSSIAGWFRSMCGTATKTNAGSTQQTGQGSTASTAGDSSSTSGSRVSNEGGGDWISNHWQWVIMIVVLVVGITAIWVGACIWRRRYLKKKDRQSHLIQKHSGSASRPSWGPGMEASEGGIPYDDESNRNSHGLMLAGAAAAGTVEEEPKEKKRWIVRDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.18
4 0.21
5 0.26
6 0.25
7 0.28
8 0.29
9 0.28
10 0.24
11 0.23
12 0.2
13 0.15
14 0.15
15 0.13
16 0.11
17 0.08
18 0.08
19 0.09
20 0.1
21 0.12
22 0.12
23 0.13
24 0.14
25 0.13
26 0.12
27 0.12
28 0.11
29 0.1
30 0.1
31 0.09
32 0.08
33 0.09
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.12
41 0.11
42 0.12
43 0.13
44 0.18
45 0.18
46 0.23
47 0.22
48 0.25
49 0.26
50 0.29
51 0.27
52 0.25
53 0.24
54 0.2
55 0.23
56 0.23
57 0.2
58 0.15
59 0.15
60 0.15
61 0.14
62 0.14
63 0.11
64 0.07
65 0.08
66 0.07
67 0.06
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.07
82 0.09
83 0.12
84 0.14
85 0.16
86 0.17
87 0.16
88 0.17
89 0.17
90 0.16
91 0.15
92 0.15
93 0.15
94 0.16
95 0.16
96 0.15
97 0.15
98 0.13
99 0.12
100 0.11
101 0.09
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.07
113 0.07
114 0.08
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.08
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.07
132 0.07
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.01
145 0.01
146 0.02
147 0.02
148 0.05
149 0.1
150 0.13
151 0.15
152 0.24
153 0.28
154 0.38
155 0.48
156 0.56
157 0.63
158 0.71
159 0.8
160 0.81
161 0.86
162 0.85
163 0.85
164 0.84
165 0.83
166 0.81
167 0.72
168 0.64
169 0.6
170 0.54
171 0.46
172 0.38
173 0.35
174 0.29
175 0.29
176 0.28
177 0.25
178 0.25
179 0.23
180 0.21
181 0.16
182 0.18
183 0.16
184 0.15
185 0.14
186 0.14
187 0.13
188 0.12
189 0.11
190 0.07
191 0.08
192 0.12
193 0.12
194 0.12
195 0.14
196 0.17
197 0.19
198 0.19
199 0.18
200 0.15
201 0.15
202 0.15
203 0.13
204 0.1
205 0.08
206 0.08
207 0.07
208 0.06
209 0.05
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.05
216 0.08
217 0.13
218 0.2
219 0.25
220 0.28
221 0.36
222 0.45
223 0.55