Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098DPS2

Protein Details
Accession A0A098DPS2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-27WTSTVQIRLKERRNKIKKKMTAGLLHydrophilic
NLS Segment(s)
PositionSequence
12-21KERRNKIKKK
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
Amino Acid Sequences MGWTSTVQIRLKERRNKIKKKMTAGLLLVAKASELQADESDADAALCSAAAPCCQVVVESRFHRRIGQGTPPSQLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.85
4 0.87
5 0.89
6 0.87
7 0.86
8 0.83
9 0.76
10 0.71
11 0.61
12 0.55
13 0.45
14 0.37
15 0.28
16 0.21
17 0.16
18 0.1
19 0.09
20 0.05
21 0.04
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.02
35 0.03
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.1
44 0.12
45 0.19
46 0.23
47 0.32
48 0.35
49 0.36
50 0.38
51 0.38
52 0.4
53 0.39
54 0.45
55 0.45
56 0.45