Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZTS2

Protein Details
Accession E4ZTS2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-41QIPFNWDCKQKWRKQRQSQSQSQSQSHydrophilic
62-88QKQNQNQNQNQKKTQNQKKTQKQKQKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MRHSRTYQGVTVPSSQIPFNWDCKQKWRKQRQSQSQSQSQSQSQSQSQNQSQNRSQNQSQIQKQNQNQNQNQKKTQNQKKTQKQKQKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.19
4 0.21
5 0.21
6 0.24
7 0.29
8 0.33
9 0.34
10 0.44
11 0.53
12 0.57
13 0.66
14 0.71
15 0.75
16 0.8
17 0.89
18 0.9
19 0.9
20 0.9
21 0.86
22 0.83
23 0.75
24 0.67
25 0.59
26 0.49
27 0.43
28 0.35
29 0.31
30 0.26
31 0.27
32 0.26
33 0.29
34 0.31
35 0.36
36 0.37
37 0.4
38 0.41
39 0.45
40 0.46
41 0.47
42 0.45
43 0.44
44 0.49
45 0.52
46 0.55
47 0.56
48 0.59
49 0.61
50 0.66
51 0.69
52 0.68
53 0.7
54 0.7
55 0.72
56 0.74
57 0.73
58 0.75
59 0.73
60 0.76
61 0.77
62 0.8
63 0.8
64 0.82
65 0.85
66 0.89
67 0.92
68 0.94