A0A0E0RSR6
Protein Details
| Accession | A0A0E0RSR6  |
Localization Confidence | Medium | Confidence Score | 10.5 | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| NoLS Segment(s) |
|
||||||||||
| NLS Segment(s) |
|
||||||||||
| Subcellular Location(s) | nucl 20.5, cyto_nucl 13, mito 4 | ||||||||||
| Family & Domain DBs |
|
||||||||||
| Amino Acid Sequences | MSDDNRFTKVRKSKKMSGLSRMNGTFTKGIY | ||||||||||
| FASTA Sequence with NoLS information |
|||||||||||
| AlphaFold Structure with highlighted NoLS |
|||||||||||
NoLS Predictions per Residue
| Residue Number | Score |
|---|---|
| 1 | 0.73 |
| 2 | 0.82 |
| 3 | 0.77 |
| 4 | 0.76 |
| 5 | 0.74 |
| 6 | 0.67 |
| 7 | 0.65 |
| 8 | 0.57 |
| 9 | 0.5 |
| 10 | 0.41 |
| 11 | 0.4 |