Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194X9J1

Protein Details
Accession A0A194X9J1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
404-424VDQIIKNPKYRKRAKEMEAEMHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002213  UDP_glucos_trans  
Gene Ontology GO:0008194  F:UDP-glycosyltransferase activity  
KEGG psco:LY89DRAFT_697142  -  
Pfam View protein in Pfam  
PF00201  UDPGT  
CDD cd03784  GT1_Gtf-like  
Amino Acid Sequences MDPTKPLVIIGCTPVYGHLMPIRAMAKLLVQRGYEVTFVSCSHYQKLVEEVGCHYVAIEGYGDWYEAELNTRFAERNTLPPGPVQLSYDIEHCFVRPIPTQHEAMQKAIKMNMERHPGRPIVQLSESVFQGSLPVNLGAGIKPTATMGIGVIPMSLSSCDTAPFGPGLPPDSSLEGRAKYAAMSKQIAELFFGKPERVWKEMFVEVGATIPELPMFDAPFYLQDRFLQMCTPSAEYPRSDAPDTIRFTGGLPKGSRDPMTEFPSFWKEITAGDKDIVFICQGTIALNYSDLIIPAMAALKDRPNTIVVVALGIKGEKFPEGTFVPENARVADYIPFDELLPRCSVFLTNGGYGAFQHAIANGVPIICGGAGEDKPEVCARVEWSGMGINLKTGQPTQEQISEAVDQIIKNPKYRKRAKEMEAEMASFDPISVVAANIDELAALKAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.18
4 0.19
5 0.18
6 0.19
7 0.19
8 0.24
9 0.23
10 0.19
11 0.2
12 0.17
13 0.2
14 0.23
15 0.26
16 0.26
17 0.25
18 0.26
19 0.28
20 0.29
21 0.24
22 0.2
23 0.18
24 0.15
25 0.15
26 0.2
27 0.22
28 0.23
29 0.26
30 0.29
31 0.28
32 0.28
33 0.32
34 0.32
35 0.29
36 0.28
37 0.27
38 0.27
39 0.26
40 0.24
41 0.2
42 0.15
43 0.14
44 0.13
45 0.1
46 0.06
47 0.08
48 0.08
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.11
55 0.1
56 0.12
57 0.12
58 0.14
59 0.15
60 0.15
61 0.22
62 0.2
63 0.26
64 0.31
65 0.32
66 0.31
67 0.31
68 0.35
69 0.3
70 0.29
71 0.24
72 0.2
73 0.21
74 0.22
75 0.23
76 0.2
77 0.19
78 0.18
79 0.16
80 0.16
81 0.15
82 0.18
83 0.21
84 0.24
85 0.28
86 0.31
87 0.33
88 0.36
89 0.42
90 0.4
91 0.38
92 0.38
93 0.34
94 0.33
95 0.33
96 0.31
97 0.26
98 0.3
99 0.33
100 0.39
101 0.39
102 0.39
103 0.42
104 0.4
105 0.39
106 0.4
107 0.35
108 0.3
109 0.29
110 0.29
111 0.27
112 0.28
113 0.25
114 0.2
115 0.18
116 0.13
117 0.14
118 0.11
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.07
126 0.08
127 0.08
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.05
136 0.06
137 0.05
138 0.05
139 0.05
140 0.04
141 0.05
142 0.05
143 0.04
144 0.05
145 0.05
146 0.06
147 0.07
148 0.07
149 0.07
150 0.08
151 0.08
152 0.08
153 0.09
154 0.11
155 0.11
156 0.12
157 0.12
158 0.15
159 0.14
160 0.15
161 0.17
162 0.15
163 0.15
164 0.14
165 0.13
166 0.11
167 0.15
168 0.15
169 0.16
170 0.17
171 0.16
172 0.2
173 0.2
174 0.2
175 0.17
176 0.17
177 0.14
178 0.15
179 0.15
180 0.12
181 0.11
182 0.17
183 0.19
184 0.2
185 0.2
186 0.19
187 0.22
188 0.23
189 0.22
190 0.16
191 0.13
192 0.11
193 0.1
194 0.09
195 0.05
196 0.04
197 0.04
198 0.04
199 0.03
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.07
207 0.09
208 0.09
209 0.09
210 0.09
211 0.12
212 0.12
213 0.12
214 0.11
215 0.1
216 0.11
217 0.12
218 0.14
219 0.12
220 0.14
221 0.15
222 0.14
223 0.16
224 0.17
225 0.18
226 0.17
227 0.17
228 0.18
229 0.24
230 0.26
231 0.25
232 0.23
233 0.2
234 0.2
235 0.26
236 0.24
237 0.21
238 0.2
239 0.2
240 0.22
241 0.24
242 0.24
243 0.19
244 0.22
245 0.23
246 0.28
247 0.27
248 0.25
249 0.26
250 0.29
251 0.28
252 0.23
253 0.19
254 0.14
255 0.15
256 0.19
257 0.18
258 0.15
259 0.15
260 0.15
261 0.14
262 0.14
263 0.13
264 0.09
265 0.07
266 0.06
267 0.05
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.06
274 0.06
275 0.07
276 0.07
277 0.06
278 0.06
279 0.05
280 0.04
281 0.04
282 0.06
283 0.05
284 0.05
285 0.07
286 0.1
287 0.12
288 0.13
289 0.14
290 0.13
291 0.14
292 0.14
293 0.15
294 0.11
295 0.11
296 0.1
297 0.09
298 0.08
299 0.08
300 0.08
301 0.06
302 0.07
303 0.06
304 0.07
305 0.07
306 0.11
307 0.11
308 0.15
309 0.16
310 0.17
311 0.2
312 0.21
313 0.21
314 0.18
315 0.18
316 0.15
317 0.14
318 0.16
319 0.14
320 0.13
321 0.13
322 0.13
323 0.12
324 0.17
325 0.16
326 0.16
327 0.16
328 0.16
329 0.15
330 0.15
331 0.16
332 0.12
333 0.16
334 0.17
335 0.16
336 0.16
337 0.16
338 0.15
339 0.15
340 0.16
341 0.12
342 0.09
343 0.09
344 0.08
345 0.1
346 0.1
347 0.11
348 0.08
349 0.08
350 0.07
351 0.07
352 0.07
353 0.05
354 0.05
355 0.05
356 0.08
357 0.08
358 0.1
359 0.12
360 0.11
361 0.14
362 0.15
363 0.16
364 0.13
365 0.15
366 0.16
367 0.18
368 0.18
369 0.16
370 0.17
371 0.17
372 0.17
373 0.17
374 0.14
375 0.12
376 0.15
377 0.15
378 0.16
379 0.15
380 0.17
381 0.17
382 0.2
383 0.23
384 0.24
385 0.25
386 0.24
387 0.26
388 0.24
389 0.22
390 0.21
391 0.19
392 0.15
393 0.19
394 0.28
395 0.27
396 0.33
397 0.41
398 0.47
399 0.56
400 0.66
401 0.72
402 0.72
403 0.8
404 0.8
405 0.82
406 0.79
407 0.79
408 0.71
409 0.62
410 0.53
411 0.43
412 0.36
413 0.26
414 0.2
415 0.1
416 0.07
417 0.08
418 0.07
419 0.06
420 0.06
421 0.07
422 0.07
423 0.07
424 0.07
425 0.06
426 0.06
427 0.07