Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XLQ2

Protein Details
Accession A0A194XLQ2    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-27HHRQNRRRERPGSRTRRSMNRKANAPFBasic
NLS Segment(s)
PositionSequence
6-20RRRERPGSRTRRSMN
Subcellular Location(s) nucl 15, mito 6, cyto 4
Family & Domain DBs
KEGG psco:LY89DRAFT_547987  -  
Amino Acid Sequences HHRQNRRRERPGSRTRRSMNRKANAPFDYTDSLLDARDASVYLPSDKAKPSPLLRQNFDQSWQRWQARKAEEKALAEMDMRQLEIEQQRLFGEDVDDEVSIPDEAMLGVVFGLFGDLDYIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.86
4 0.85
5 0.84
6 0.83
7 0.81
8 0.81
9 0.76
10 0.76
11 0.67
12 0.61
13 0.52
14 0.46
15 0.4
16 0.32
17 0.28
18 0.21
19 0.19
20 0.15
21 0.14
22 0.1
23 0.07
24 0.07
25 0.07
26 0.06
27 0.07
28 0.08
29 0.09
30 0.1
31 0.11
32 0.13
33 0.14
34 0.15
35 0.16
36 0.19
37 0.22
38 0.29
39 0.36
40 0.4
41 0.42
42 0.44
43 0.45
44 0.41
45 0.41
46 0.38
47 0.31
48 0.31
49 0.35
50 0.35
51 0.35
52 0.37
53 0.41
54 0.42
55 0.48
56 0.46
57 0.46
58 0.45
59 0.43
60 0.42
61 0.35
62 0.29
63 0.22
64 0.19
65 0.15
66 0.11
67 0.1
68 0.08
69 0.08
70 0.12
71 0.14
72 0.17
73 0.15
74 0.15
75 0.15
76 0.17
77 0.17
78 0.13
79 0.12
80 0.08
81 0.09
82 0.1
83 0.1
84 0.08
85 0.08
86 0.09
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04