Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XGM9

Protein Details
Accession A0A194XGM9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTDRGRKKERKKKRNNAIACLASHydrophilic
NLS Segment(s)
PositionSequence
4-14RGRKKERKKKR
Subcellular Location(s) plas 7, mito 6, golg 4, cyto_mito 4, nucl 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_489044  -  
Amino Acid Sequences MTDRGRKKERKKKRNNAIACLASIGGFDRLLMHDRFHHADEHTGSVVVCGEMIPLNLDYYYSSICFSSFLFFSFLFSILR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.91
3 0.88
4 0.85
5 0.76
6 0.64
7 0.54
8 0.43
9 0.32
10 0.24
11 0.17
12 0.09
13 0.07
14 0.06
15 0.06
16 0.07
17 0.11
18 0.11
19 0.11
20 0.12
21 0.15
22 0.17
23 0.18
24 0.18
25 0.15
26 0.18
27 0.18
28 0.18
29 0.15
30 0.13
31 0.11
32 0.1
33 0.09
34 0.06
35 0.05
36 0.03
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.09
48 0.08
49 0.09
50 0.08
51 0.09
52 0.09
53 0.09
54 0.11
55 0.1
56 0.11
57 0.14
58 0.13
59 0.16
60 0.16