Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5ABH2

Protein Details
Accession E5ABH2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-50LPPNVRKITKRPAEPPKKNWPQGFRRRHPEIKLRSNRAMHydrophilic
NLS Segment(s)
PositionSequence
17-45RKITKRPAEPPKKNWPQGFRRRHPEIKLR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.333, cyto 6, cyto_pero 4.333, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences MDPASQALALDLPPNVRKITKRPAEPPKKNWPQGFRRRHPEIKLRSNRAMPWERHDNNIYDKVKKWFNVIEKELRRPDVLPKNVYNMDKTGIMLSMLGSVKVLVGKDDRRSYRGASVKRTMVTAIECISASGYNDSYISLKWIKRVFDPQTKARANQKPQILICDGFRTHETLEVLEFCFKNNVILCRLPSHTSHKLQPCDVSVFGPLKTAYQDKVELLYRGGLTTINKEHFTTIYSPARKRAMTKKNILAGWAKTGLFPFNPPRVLRDITKPDAPLTVALMTVPIPCVDASDVMYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.23
4 0.28
5 0.34
6 0.44
7 0.49
8 0.55
9 0.63
10 0.72
11 0.79
12 0.83
13 0.84
14 0.84
15 0.86
16 0.86
17 0.84
18 0.83
19 0.82
20 0.84
21 0.86
22 0.85
23 0.83
24 0.84
25 0.84
26 0.83
27 0.82
28 0.81
29 0.81
30 0.82
31 0.8
32 0.78
33 0.75
34 0.69
35 0.69
36 0.67
37 0.59
38 0.56
39 0.59
40 0.54
41 0.55
42 0.54
43 0.48
44 0.46
45 0.52
46 0.48
47 0.41
48 0.43
49 0.44
50 0.46
51 0.43
52 0.41
53 0.38
54 0.43
55 0.47
56 0.49
57 0.53
58 0.53
59 0.6
60 0.59
61 0.55
62 0.49
63 0.42
64 0.46
65 0.46
66 0.47
67 0.44
68 0.42
69 0.46
70 0.49
71 0.49
72 0.41
73 0.32
74 0.28
75 0.23
76 0.22
77 0.17
78 0.12
79 0.11
80 0.09
81 0.08
82 0.1
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.09
89 0.09
90 0.06
91 0.1
92 0.13
93 0.19
94 0.26
95 0.27
96 0.28
97 0.3
98 0.31
99 0.35
100 0.4
101 0.39
102 0.38
103 0.41
104 0.42
105 0.4
106 0.39
107 0.31
108 0.25
109 0.21
110 0.16
111 0.12
112 0.1
113 0.09
114 0.09
115 0.09
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.07
123 0.07
124 0.07
125 0.09
126 0.12
127 0.12
128 0.17
129 0.2
130 0.2
131 0.22
132 0.3
133 0.33
134 0.37
135 0.41
136 0.41
137 0.48
138 0.48
139 0.49
140 0.51
141 0.52
142 0.49
143 0.5
144 0.49
145 0.44
146 0.43
147 0.44
148 0.36
149 0.29
150 0.25
151 0.23
152 0.19
153 0.16
154 0.16
155 0.14
156 0.13
157 0.15
158 0.14
159 0.11
160 0.12
161 0.11
162 0.12
163 0.13
164 0.13
165 0.1
166 0.11
167 0.11
168 0.13
169 0.14
170 0.16
171 0.16
172 0.18
173 0.19
174 0.21
175 0.23
176 0.22
177 0.23
178 0.29
179 0.33
180 0.34
181 0.41
182 0.45
183 0.46
184 0.45
185 0.44
186 0.39
187 0.35
188 0.32
189 0.25
190 0.21
191 0.2
192 0.18
193 0.18
194 0.15
195 0.13
196 0.15
197 0.16
198 0.14
199 0.15
200 0.17
201 0.15
202 0.19
203 0.2
204 0.18
205 0.17
206 0.18
207 0.15
208 0.14
209 0.14
210 0.12
211 0.11
212 0.16
213 0.2
214 0.2
215 0.21
216 0.22
217 0.23
218 0.21
219 0.23
220 0.21
221 0.24
222 0.3
223 0.35
224 0.36
225 0.41
226 0.45
227 0.44
228 0.48
229 0.51
230 0.53
231 0.56
232 0.63
233 0.65
234 0.66
235 0.65
236 0.61
237 0.56
238 0.47
239 0.43
240 0.38
241 0.3
242 0.24
243 0.25
244 0.25
245 0.2
246 0.24
247 0.26
248 0.29
249 0.34
250 0.34
251 0.37
252 0.4
253 0.43
254 0.42
255 0.44
256 0.47
257 0.47
258 0.5
259 0.48
260 0.44
261 0.41
262 0.39
263 0.3
264 0.24
265 0.19
266 0.15
267 0.13
268 0.13
269 0.11
270 0.11
271 0.1
272 0.08
273 0.08
274 0.08
275 0.1
276 0.11
277 0.11