Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194WT42

Protein Details
Accession A0A194WT42   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-103IVIVQNPPKKEKKRHRSIIRPISLHydrophilic
NLS Segment(s)
PositionSequence
87-96PKKEKKRHRS
Subcellular Location(s) nucl 16, mito 7, cyto 2
Family & Domain DBs
KEGG psco:LY89DRAFT_237321  -  
Amino Acid Sequences MYNNIQESRSLLLFLLLLLLERPPYSYNIFLGKEKIPENASTFRRKGIVLIEILSAPTLILTRQEHFCKQEKITRLRSPIVIVQNPPKKEKKRHRSIIRPISL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.06
4 0.06
5 0.05
6 0.06
7 0.06
8 0.06
9 0.08
10 0.08
11 0.11
12 0.14
13 0.15
14 0.16
15 0.21
16 0.23
17 0.22
18 0.24
19 0.23
20 0.24
21 0.23
22 0.24
23 0.21
24 0.21
25 0.24
26 0.27
27 0.3
28 0.33
29 0.32
30 0.31
31 0.3
32 0.28
33 0.26
34 0.21
35 0.19
36 0.13
37 0.13
38 0.13
39 0.11
40 0.11
41 0.1
42 0.07
43 0.05
44 0.04
45 0.03
46 0.03
47 0.06
48 0.08
49 0.1
50 0.15
51 0.18
52 0.21
53 0.25
54 0.31
55 0.32
56 0.34
57 0.39
58 0.43
59 0.47
60 0.53
61 0.55
62 0.54
63 0.52
64 0.5
65 0.47
66 0.45
67 0.45
68 0.4
69 0.38
70 0.43
71 0.47
72 0.49
73 0.53
74 0.56
75 0.58
76 0.65
77 0.73
78 0.74
79 0.78
80 0.86
81 0.91
82 0.92
83 0.94