Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XT57

Protein Details
Accession A0A194XT57    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-73MPQERRYYTKKKSTHNRSSCTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 6, cyto_mito 6, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_313225  -  
Amino Acid Sequences MGTTLSKTSSINTIQKQSKINMDISTISILVLWYAQGFLIIITSLKRIDNAMPQERRYYTKKKSTHNRSSCTTFDVFAVLQYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.5
4 0.47
5 0.48
6 0.44
7 0.42
8 0.34
9 0.31
10 0.27
11 0.25
12 0.23
13 0.16
14 0.12
15 0.1
16 0.09
17 0.07
18 0.05
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.05
33 0.06
34 0.07
35 0.08
36 0.14
37 0.2
38 0.28
39 0.31
40 0.32
41 0.36
42 0.37
43 0.41
44 0.41
45 0.44
46 0.44
47 0.51
48 0.57
49 0.63
50 0.72
51 0.78
52 0.83
53 0.83
54 0.8
55 0.77
56 0.76
57 0.67
58 0.61
59 0.52
60 0.41
61 0.32
62 0.29
63 0.22