Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132BAU4

Protein Details
Accession A0A132BAU4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
194-219EYNEDGKKDKKTKRWRRTVEQALVKMHydrophilic
268-289IVLLWLRKRKDRRIEDLVREGLHydrophilic
NLS Segment(s)
PositionSequence
201-209KDKKTKRWR
Subcellular Location(s) cyto 14.5, cyto_mito 9.5, nucl 5, mito 3.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000582  Acyl-CoA-binding_protein  
IPR035984  Acyl-CoA-binding_sf  
IPR014352  FERM/acyl-CoA-bd_prot_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0000062  F:fatty-acyl-CoA binding  
KEGG psco:LY89DRAFT_320142  -  
Pfam View protein in Pfam  
PF00887  ACBP  
PROSITE View protein in PROSITE  
PS51228  ACB_2  
Amino Acid Sequences MADSVDRVFVHALNTVKKIPKTGASRPPPADRLRLYGLYKQAMEGDVDGVMERPGSVGEGEHEPEDVKKDRDKYDAWDAQRGISRTEAKRRYIEALIETMHKYASTTADARALVDELEFVWDQIKNNSASSSGSSPGRHGVPSYTTNTQPRQFQPPLSGNDGPMRVLSPMSQDDEAEQESERRLDVYDEYDDDEYNEDGKKDKKTKRWRRTVEQALVKMTAEIAALREQIATGREYQGKKRRSFGRWVAWFIWIVARHFLVDMVVLGIVLLWLRKRKDRRIEDLVREGLKIGREYVRKILPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.36
4 0.36
5 0.38
6 0.37
7 0.42
8 0.45
9 0.51
10 0.56
11 0.58
12 0.65
13 0.67
14 0.7
15 0.69
16 0.65
17 0.64
18 0.56
19 0.54
20 0.51
21 0.51
22 0.47
23 0.46
24 0.47
25 0.43
26 0.4
27 0.35
28 0.31
29 0.26
30 0.23
31 0.18
32 0.13
33 0.1
34 0.1
35 0.09
36 0.08
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.08
46 0.1
47 0.12
48 0.12
49 0.12
50 0.12
51 0.12
52 0.17
53 0.18
54 0.19
55 0.24
56 0.29
57 0.32
58 0.36
59 0.37
60 0.38
61 0.45
62 0.49
63 0.45
64 0.46
65 0.43
66 0.42
67 0.45
68 0.39
69 0.3
70 0.29
71 0.34
72 0.32
73 0.42
74 0.45
75 0.44
76 0.47
77 0.48
78 0.47
79 0.42
80 0.39
81 0.31
82 0.27
83 0.24
84 0.23
85 0.21
86 0.17
87 0.14
88 0.12
89 0.1
90 0.1
91 0.1
92 0.11
93 0.11
94 0.12
95 0.15
96 0.15
97 0.15
98 0.14
99 0.12
100 0.09
101 0.08
102 0.07
103 0.04
104 0.07
105 0.06
106 0.06
107 0.07
108 0.08
109 0.09
110 0.1
111 0.13
112 0.11
113 0.12
114 0.12
115 0.11
116 0.11
117 0.12
118 0.13
119 0.12
120 0.13
121 0.13
122 0.13
123 0.15
124 0.15
125 0.14
126 0.13
127 0.12
128 0.13
129 0.16
130 0.19
131 0.19
132 0.21
133 0.25
134 0.28
135 0.29
136 0.3
137 0.3
138 0.34
139 0.33
140 0.31
141 0.33
142 0.34
143 0.35
144 0.36
145 0.34
146 0.27
147 0.28
148 0.28
149 0.22
150 0.17
151 0.15
152 0.09
153 0.09
154 0.08
155 0.08
156 0.09
157 0.11
158 0.11
159 0.11
160 0.11
161 0.12
162 0.12
163 0.1
164 0.09
165 0.08
166 0.08
167 0.09
168 0.08
169 0.07
170 0.07
171 0.08
172 0.08
173 0.1
174 0.11
175 0.11
176 0.13
177 0.13
178 0.13
179 0.12
180 0.12
181 0.1
182 0.1
183 0.1
184 0.08
185 0.11
186 0.14
187 0.22
188 0.3
189 0.37
190 0.47
191 0.57
192 0.69
193 0.77
194 0.84
195 0.85
196 0.85
197 0.88
198 0.88
199 0.86
200 0.82
201 0.74
202 0.65
203 0.57
204 0.47
205 0.37
206 0.26
207 0.18
208 0.1
209 0.08
210 0.07
211 0.08
212 0.08
213 0.08
214 0.08
215 0.07
216 0.09
217 0.1
218 0.1
219 0.1
220 0.14
221 0.2
222 0.23
223 0.33
224 0.4
225 0.47
226 0.5
227 0.57
228 0.61
229 0.6
230 0.68
231 0.67
232 0.69
233 0.66
234 0.69
235 0.61
236 0.55
237 0.5
238 0.41
239 0.37
240 0.28
241 0.24
242 0.21
243 0.19
244 0.18
245 0.17
246 0.17
247 0.11
248 0.09
249 0.08
250 0.06
251 0.06
252 0.05
253 0.05
254 0.04
255 0.04
256 0.04
257 0.05
258 0.08
259 0.14
260 0.18
261 0.28
262 0.37
263 0.47
264 0.58
265 0.66
266 0.72
267 0.76
268 0.82
269 0.82
270 0.81
271 0.77
272 0.68
273 0.59
274 0.51
275 0.43
276 0.37
277 0.3
278 0.26
279 0.27
280 0.3
281 0.33
282 0.4
283 0.44