Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194WUZ9

Protein Details
Accession A0A194WUZ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
204-229AGVDPSKKPPTRKKRKIPRSATPALWHydrophilic
NLS Segment(s)
PositionSequence
210-223KKPPTRKKRKIPRS
Subcellular Location(s) plas 9, cyto 7.5, mito 7, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004299  MBOAT_fam  
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_786650  -  
Pfam View protein in Pfam  
PF03062  MBOAT  
Amino Acid Sequences MLPYINLPFEYVAGILGTSADELKLITSFLLSYPLAGLLKRVPDEKPALKNLFIISVSTFYLVGLFDLWDGYRTLAVSSVGAYCIAQYVQGPFMPWIGFLFLMGHLSINQLARQFLNDPGVIDITGAQMVLVMKLTAFCWNVADGRLPEEDLSDFQKERAMKRLPSLLDFAGYVLFFPSLMAGPAFDYVDYKRWIETTMFEVPAGVDPSKKPPTRKKRKIPRSATPALWKAASGLFWILMFLQLSGWFYPDLLTGDTYMTYGFTRRVWILHMLGVTTRTKYYGVWALTEGACILSGLGYKGVDPATGKVSWDRLRNVSPWGVESAQNCRAYLGNWNINTNNWLRNYVYLRVTPRGKKPGFRASMATFVTSAFWHGFYPGYYLTFVLASFVQTAAKNCRRYLRPFVLDPKTAQPTSAKIYYDVASWFATQLIFSFTTAPFVLLTLPASFLVWARVYFYAVIVTTLTTAFFASPGKAFLVKKLNRRAGTTGPLKRTHSQESLTSKEPVLGLPSEPQEDLEELVSEVKAEMESRQRKGSKSVKAPYFPSKSTKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.05
8 0.05
9 0.06
10 0.07
11 0.07
12 0.07
13 0.06
14 0.07
15 0.07
16 0.07
17 0.12
18 0.11
19 0.11
20 0.11
21 0.14
22 0.14
23 0.13
24 0.15
25 0.15
26 0.2
27 0.22
28 0.24
29 0.22
30 0.28
31 0.36
32 0.42
33 0.45
34 0.49
35 0.5
36 0.48
37 0.5
38 0.44
39 0.4
40 0.33
41 0.27
42 0.2
43 0.18
44 0.18
45 0.16
46 0.15
47 0.1
48 0.11
49 0.09
50 0.08
51 0.07
52 0.07
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09
63 0.1
64 0.09
65 0.1
66 0.1
67 0.09
68 0.09
69 0.09
70 0.07
71 0.08
72 0.08
73 0.07
74 0.07
75 0.09
76 0.11
77 0.11
78 0.13
79 0.12
80 0.14
81 0.13
82 0.12
83 0.11
84 0.1
85 0.1
86 0.09
87 0.09
88 0.08
89 0.09
90 0.09
91 0.08
92 0.07
93 0.08
94 0.11
95 0.1
96 0.12
97 0.12
98 0.13
99 0.13
100 0.15
101 0.16
102 0.16
103 0.18
104 0.17
105 0.17
106 0.17
107 0.17
108 0.15
109 0.13
110 0.11
111 0.08
112 0.08
113 0.07
114 0.05
115 0.06
116 0.06
117 0.06
118 0.06
119 0.05
120 0.05
121 0.06
122 0.07
123 0.09
124 0.1
125 0.1
126 0.11
127 0.12
128 0.13
129 0.13
130 0.16
131 0.13
132 0.15
133 0.15
134 0.15
135 0.14
136 0.14
137 0.14
138 0.12
139 0.15
140 0.15
141 0.15
142 0.14
143 0.18
144 0.2
145 0.21
146 0.28
147 0.3
148 0.29
149 0.33
150 0.39
151 0.37
152 0.36
153 0.37
154 0.29
155 0.24
156 0.22
157 0.19
158 0.13
159 0.11
160 0.09
161 0.06
162 0.06
163 0.05
164 0.05
165 0.05
166 0.04
167 0.05
168 0.05
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.07
175 0.08
176 0.12
177 0.14
178 0.14
179 0.13
180 0.14
181 0.16
182 0.15
183 0.15
184 0.16
185 0.18
186 0.18
187 0.18
188 0.17
189 0.16
190 0.17
191 0.17
192 0.12
193 0.1
194 0.1
195 0.18
196 0.26
197 0.29
198 0.35
199 0.43
200 0.55
201 0.65
202 0.75
203 0.79
204 0.82
205 0.9
206 0.93
207 0.91
208 0.9
209 0.87
210 0.82
211 0.75
212 0.7
213 0.62
214 0.52
215 0.43
216 0.33
217 0.25
218 0.21
219 0.17
220 0.11
221 0.08
222 0.07
223 0.06
224 0.07
225 0.05
226 0.05
227 0.05
228 0.04
229 0.04
230 0.04
231 0.06
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.07
239 0.07
240 0.07
241 0.07
242 0.07
243 0.07
244 0.07
245 0.06
246 0.06
247 0.05
248 0.06
249 0.06
250 0.07
251 0.08
252 0.09
253 0.09
254 0.1
255 0.12
256 0.12
257 0.13
258 0.12
259 0.11
260 0.11
261 0.12
262 0.11
263 0.09
264 0.09
265 0.08
266 0.09
267 0.08
268 0.11
269 0.14
270 0.14
271 0.14
272 0.14
273 0.15
274 0.15
275 0.15
276 0.12
277 0.07
278 0.06
279 0.05
280 0.05
281 0.03
282 0.03
283 0.04
284 0.04
285 0.04
286 0.04
287 0.06
288 0.06
289 0.06
290 0.06
291 0.07
292 0.1
293 0.1
294 0.1
295 0.1
296 0.16
297 0.19
298 0.22
299 0.24
300 0.24
301 0.26
302 0.27
303 0.29
304 0.26
305 0.22
306 0.2
307 0.2
308 0.18
309 0.18
310 0.18
311 0.2
312 0.24
313 0.24
314 0.23
315 0.22
316 0.21
317 0.19
318 0.24
319 0.25
320 0.24
321 0.24
322 0.26
323 0.26
324 0.26
325 0.28
326 0.24
327 0.22
328 0.17
329 0.19
330 0.17
331 0.21
332 0.24
333 0.26
334 0.26
335 0.26
336 0.28
337 0.32
338 0.38
339 0.39
340 0.43
341 0.49
342 0.49
343 0.5
344 0.54
345 0.58
346 0.56
347 0.52
348 0.5
349 0.42
350 0.46
351 0.41
352 0.35
353 0.25
354 0.21
355 0.2
356 0.15
357 0.14
358 0.08
359 0.09
360 0.08
361 0.08
362 0.09
363 0.08
364 0.11
365 0.1
366 0.1
367 0.1
368 0.1
369 0.1
370 0.1
371 0.09
372 0.08
373 0.07
374 0.07
375 0.07
376 0.07
377 0.09
378 0.09
379 0.12
380 0.2
381 0.27
382 0.3
383 0.32
384 0.4
385 0.43
386 0.49
387 0.56
388 0.56
389 0.54
390 0.56
391 0.63
392 0.61
393 0.58
394 0.54
395 0.5
396 0.47
397 0.42
398 0.38
399 0.31
400 0.28
401 0.31
402 0.33
403 0.27
404 0.22
405 0.25
406 0.24
407 0.24
408 0.21
409 0.17
410 0.15
411 0.14
412 0.13
413 0.11
414 0.1
415 0.09
416 0.09
417 0.1
418 0.1
419 0.1
420 0.12
421 0.11
422 0.14
423 0.14
424 0.14
425 0.11
426 0.1
427 0.11
428 0.09
429 0.1
430 0.08
431 0.08
432 0.08
433 0.08
434 0.08
435 0.08
436 0.1
437 0.1
438 0.1
439 0.12
440 0.12
441 0.13
442 0.13
443 0.13
444 0.12
445 0.11
446 0.11
447 0.09
448 0.09
449 0.08
450 0.08
451 0.08
452 0.06
453 0.07
454 0.06
455 0.07
456 0.08
457 0.09
458 0.09
459 0.11
460 0.12
461 0.17
462 0.17
463 0.23
464 0.33
465 0.37
466 0.46
467 0.55
468 0.62
469 0.6
470 0.64
471 0.63
472 0.58
473 0.61
474 0.62
475 0.59
476 0.57
477 0.6
478 0.61
479 0.61
480 0.61
481 0.6
482 0.55
483 0.5
484 0.51
485 0.53
486 0.53
487 0.51
488 0.47
489 0.4
490 0.37
491 0.35
492 0.27
493 0.24
494 0.2
495 0.18
496 0.2
497 0.23
498 0.22
499 0.22
500 0.22
501 0.21
502 0.2
503 0.2
504 0.16
505 0.14
506 0.12
507 0.13
508 0.12
509 0.1
510 0.09
511 0.09
512 0.08
513 0.09
514 0.12
515 0.22
516 0.29
517 0.33
518 0.42
519 0.46
520 0.48
521 0.57
522 0.62
523 0.62
524 0.65
525 0.71
526 0.7
527 0.72
528 0.75
529 0.76
530 0.74
531 0.67