Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XGL8

Protein Details
Accession A0A194XGL8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRLSKFQKARQRKRLRAVDTVHydrophilic
76-105DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKKYRKGIHKLP
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG psco:LY89DRAFT_683199  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNSLGGGLLWKIPWRLSKFQKARQRKRLRAVDTVVAVVDQALAKKSITTKAVERWKEEMPIEQEMVPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.12
5 0.12
6 0.15
7 0.21
8 0.26
9 0.34
10 0.41
11 0.51
12 0.58
13 0.66
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.87
20 0.88
21 0.88
22 0.83
23 0.79
24 0.71
25 0.64
26 0.54
27 0.45
28 0.35
29 0.25
30 0.19
31 0.12
32 0.09
33 0.05
34 0.04
35 0.05
36 0.05
37 0.05
38 0.06
39 0.08
40 0.1
41 0.12
42 0.13
43 0.15
44 0.22
45 0.3
46 0.32
47 0.33
48 0.33
49 0.33
50 0.34
51 0.33
52 0.3
53 0.25
54 0.25
55 0.23
56 0.21
57 0.22
58 0.2
59 0.23
60 0.19
61 0.16
62 0.15
63 0.16
64 0.18
65 0.21
66 0.3
67 0.3
68 0.39
69 0.46
70 0.54
71 0.63
72 0.69
73 0.71
74 0.73
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79