Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B6Z1

Protein Details
Accession A0A132B6Z1   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-152TPLPGVRKPKEKRPRNKHIAKTWSLEHydrophilic
NLS Segment(s)
PositionSequence
132-147VRKPKEKRPRNKHIAK
Subcellular Location(s) nucl 10.5, mito_nucl 10.333, mito 9, cyto_mito 7.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040151  Gfd2/YDR514C-like  
KEGG psco:LY89DRAFT_349939  -  
Amino Acid Sequences MPNLLRNFFGVVRRDRNIVLVGHGFGGLTALSSLGFDFQTSVIGILDTANLSFELEMDRSTLGRLLGELECPKSSAKLHNAGNDANFTLRALILLAIKGYEQQRLRTLMVGDEQVSRVLSLRSIAMTPLPGVRKPKEKRPRNKHIAKTWSLEKQEQIREERRQKRITNTAVAFREPEEDPPEYDPADLTACSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.4
4 0.37
5 0.31
6 0.28
7 0.23
8 0.21
9 0.19
10 0.18
11 0.15
12 0.12
13 0.11
14 0.07
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.07
27 0.07
28 0.08
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.07
50 0.07
51 0.07
52 0.09
53 0.09
54 0.11
55 0.12
56 0.13
57 0.13
58 0.14
59 0.14
60 0.13
61 0.14
62 0.18
63 0.21
64 0.26
65 0.28
66 0.31
67 0.33
68 0.32
69 0.31
70 0.26
71 0.22
72 0.15
73 0.13
74 0.08
75 0.07
76 0.06
77 0.05
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.07
86 0.08
87 0.12
88 0.13
89 0.15
90 0.18
91 0.2
92 0.21
93 0.2
94 0.2
95 0.15
96 0.16
97 0.15
98 0.13
99 0.11
100 0.11
101 0.1
102 0.09
103 0.08
104 0.08
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.11
116 0.12
117 0.14
118 0.2
119 0.23
120 0.33
121 0.37
122 0.48
123 0.55
124 0.63
125 0.72
126 0.77
127 0.84
128 0.85
129 0.91
130 0.89
131 0.88
132 0.87
133 0.8
134 0.75
135 0.7
136 0.67
137 0.61
138 0.54
139 0.49
140 0.48
141 0.49
142 0.49
143 0.5
144 0.5
145 0.56
146 0.64
147 0.69
148 0.7
149 0.72
150 0.72
151 0.74
152 0.76
153 0.72
154 0.71
155 0.65
156 0.65
157 0.59
158 0.55
159 0.47
160 0.38
161 0.36
162 0.27
163 0.28
164 0.24
165 0.24
166 0.24
167 0.26
168 0.28
169 0.25
170 0.24
171 0.2
172 0.17
173 0.17