Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZRK0

Protein Details
Accession E4ZRK0    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
140-162PCTGIARVKRWKRAQRLHLDPPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPPKRRSSGPAAKSSQSTLAFHGASNKVTKSGARPQGAKKGLLSDTKPKTPTQPEVTNIENDEPSTTEVAILEQAEQEVKAQEVESTPEEEAARRMTDASIKKYWAAKEKQRKAPRVHQQELTVHEKILREFDMSAHYGPCTGIARVKRWKRAQRLHLDPPLAVLAVLLKEQDKEGDSKDKLAYQRSIVDELLNSKTDVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.44
4 0.38
5 0.31
6 0.31
7 0.28
8 0.27
9 0.31
10 0.26
11 0.26
12 0.28
13 0.26
14 0.22
15 0.23
16 0.25
17 0.24
18 0.32
19 0.38
20 0.4
21 0.45
22 0.49
23 0.58
24 0.59
25 0.54
26 0.45
27 0.42
28 0.41
29 0.41
30 0.39
31 0.39
32 0.42
33 0.46
34 0.47
35 0.42
36 0.46
37 0.47
38 0.5
39 0.49
40 0.48
41 0.46
42 0.48
43 0.49
44 0.43
45 0.38
46 0.32
47 0.24
48 0.19
49 0.17
50 0.13
51 0.12
52 0.11
53 0.1
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.08
72 0.09
73 0.1
74 0.1
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.1
81 0.08
82 0.09
83 0.07
84 0.13
85 0.16
86 0.2
87 0.2
88 0.2
89 0.22
90 0.25
91 0.27
92 0.3
93 0.33
94 0.37
95 0.46
96 0.55
97 0.63
98 0.68
99 0.73
100 0.72
101 0.76
102 0.77
103 0.76
104 0.71
105 0.64
106 0.6
107 0.56
108 0.54
109 0.5
110 0.4
111 0.3
112 0.28
113 0.26
114 0.23
115 0.22
116 0.17
117 0.12
118 0.12
119 0.13
120 0.14
121 0.15
122 0.15
123 0.13
124 0.12
125 0.11
126 0.11
127 0.12
128 0.11
129 0.1
130 0.14
131 0.17
132 0.23
133 0.33
134 0.4
135 0.48
136 0.56
137 0.65
138 0.71
139 0.78
140 0.81
141 0.82
142 0.83
143 0.83
144 0.79
145 0.71
146 0.6
147 0.52
148 0.43
149 0.32
150 0.23
151 0.14
152 0.09
153 0.08
154 0.08
155 0.07
156 0.07
157 0.08
158 0.08
159 0.1
160 0.11
161 0.12
162 0.16
163 0.25
164 0.25
165 0.28
166 0.3
167 0.34
168 0.36
169 0.4
170 0.39
171 0.34
172 0.39
173 0.39
174 0.4
175 0.34
176 0.32
177 0.28
178 0.29
179 0.29
180 0.24
181 0.2