Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XJY4

Protein Details
Accession A0A194XJY4   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-83LSKNCGECNRRRKKCDREKPCGWCKKRBasic
108-128NKAKGKGKAKGKGKAKSKGKABasic
NLS Segment(s)
PositionSequence
109-128KAKGKGKAKGKGKAKSKGKA
Subcellular Location(s) nucl 15.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG psco:LY89DRAFT_716543  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPRVLRSSKTALLNSNGGSNTKSRKATRNRSATGVKGKRSTSTFVPAPASASANRILSKNCGECNRRRKKCDREKPCGWCKKRGILCRYDQTVTEGRESDPVLLKDLNKAKGKGKAKGKGKAKSKGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.3
4 0.25
5 0.23
6 0.24
7 0.26
8 0.29
9 0.35
10 0.36
11 0.45
12 0.54
13 0.64
14 0.7
15 0.73
16 0.69
17 0.69
18 0.68
19 0.65
20 0.65
21 0.6
22 0.55
23 0.5
24 0.49
25 0.46
26 0.45
27 0.42
28 0.34
29 0.35
30 0.31
31 0.28
32 0.29
33 0.25
34 0.24
35 0.22
36 0.2
37 0.14
38 0.15
39 0.14
40 0.14
41 0.14
42 0.13
43 0.13
44 0.14
45 0.17
46 0.18
47 0.19
48 0.24
49 0.27
50 0.34
51 0.45
52 0.53
53 0.57
54 0.62
55 0.68
56 0.73
57 0.81
58 0.83
59 0.82
60 0.8
61 0.82
62 0.84
63 0.85
64 0.84
65 0.77
66 0.75
67 0.7
68 0.7
69 0.69
70 0.68
71 0.64
72 0.61
73 0.64
74 0.62
75 0.61
76 0.53
77 0.46
78 0.42
79 0.41
80 0.36
81 0.32
82 0.26
83 0.22
84 0.24
85 0.24
86 0.22
87 0.22
88 0.2
89 0.21
90 0.22
91 0.22
92 0.27
93 0.33
94 0.37
95 0.37
96 0.4
97 0.42
98 0.5
99 0.56
100 0.57
101 0.6
102 0.63
103 0.66
104 0.73
105 0.77
106 0.77
107 0.8
108 0.81