Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A132BDK2

Protein Details
Accession A0A132BDK2    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
29-50AEREEKEKKKERRAAPGRERKLBasic
NLS Segment(s)
PositionSequence
33-49EKEKKKERRAAPGRERK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
KEGG psco:LY89DRAFT_787482  -  
Amino Acid Sequences MFAPPPPTTPESVDMQLEAQLAQTMAEAAEREEKEKKKERRAAPGRERKLVNLTVTTNSSDAVGRSDRIRRKRPSIETLRRGHQQPSAFCVNAESRAVAIENHVKIPDGANAPNSKGATYVHKELDRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.22
4 0.18
5 0.15
6 0.1
7 0.09
8 0.08
9 0.07
10 0.07
11 0.05
12 0.05
13 0.06
14 0.06
15 0.06
16 0.13
17 0.13
18 0.17
19 0.24
20 0.28
21 0.35
22 0.45
23 0.53
24 0.57
25 0.65
26 0.69
27 0.73
28 0.78
29 0.81
30 0.82
31 0.84
32 0.78
33 0.75
34 0.7
35 0.6
36 0.56
37 0.48
38 0.39
39 0.3
40 0.27
41 0.22
42 0.23
43 0.22
44 0.16
45 0.13
46 0.12
47 0.1
48 0.09
49 0.09
50 0.08
51 0.08
52 0.1
53 0.17
54 0.23
55 0.31
56 0.4
57 0.43
58 0.51
59 0.59
60 0.63
61 0.66
62 0.71
63 0.73
64 0.72
65 0.71
66 0.68
67 0.64
68 0.59
69 0.52
70 0.46
71 0.41
72 0.34
73 0.35
74 0.35
75 0.3
76 0.28
77 0.29
78 0.25
79 0.22
80 0.21
81 0.16
82 0.12
83 0.12
84 0.13
85 0.1
86 0.12
87 0.16
88 0.16
89 0.18
90 0.18
91 0.18
92 0.18
93 0.19
94 0.21
95 0.17
96 0.18
97 0.22
98 0.23
99 0.25
100 0.29
101 0.28
102 0.23
103 0.21
104 0.22
105 0.25
106 0.29
107 0.33
108 0.35