FuNGI

A0A194XWV0

Protein Details

Accession

A0A194XWV0

Localization Confidence

Medium

Confidence Score

11.7

NoLS Segment(s)

Position	Sequence	Protein Nature
43-70	ICSTVRPVKRAGRRPQHRKQSLLRTTPS	Hydrophilic

NLS Segment(s)

Position	Sequence
52-57	RAGRRP

Subcellular Location(s)

nucl 12.5, cyto_nucl 8.5, mito 5, plas 4, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding
KEGG	psco:LY89DRAFT_25815 -
CDD	cd00067 GAL4

Amino Acid Sequences

MATSRGQSRKVRTACDRCYELKERCTRTSITIECKRCQRLDIICSTVRPVKRAGRRPQHRKQSLLRTTPSCQSSNAAADAVNIAMWLQSVSDLNQKEKELLTFLLGRPETLDCYVVGSSFQAAEQRSLMAPLPAALPVLKDAYLAYAGALKLSQPSNVTEVDKEIGLRYASSAMTTLMSLPVATFQDANLCLTLGTVLALYVYSAVGVGMADICHYCLSTTSSFIKTAGSDTEMDSWQSFLVLLEIMDCVVHRRRPTLRIQVQTLESVDRHLGLCVPLLPYYYDLCVISHTLRSSADTSYSVHIQKQLDGIHQAIEEWQPSHGDLVDKFEAAEVVNLLAQAKVYRLAGLLISHRLRYVFGQQDRQADTWSKEIMMELELARKFTKQSIRCVTMPFIAAAIEIRDPSARLKALKNVDEYVDQFTPVVQEATRTFLERVWHERDVKITTCWFDSLSKPCVVLNSIDAACFG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.74
2	0.74
3	0.72
4	0.66
5	0.69
6	0.69
7	0.66
8	0.65
9	0.67
10	0.66
11	0.64
12	0.65
13	0.59
14	0.56
15	0.58
16	0.55
17	0.55
18	0.58
19	0.6
20	0.61
21	0.67
22	0.68
23	0.61
24	0.57
25	0.55
26	0.53
27	0.54
28	0.55
29	0.52
30	0.48
31	0.47
32	0.49
33	0.48
34	0.42
35	0.37
36	0.37
37	0.4
38	0.48
39	0.57
40	0.64
41	0.68
42	0.77
43	0.85
44	0.89
45	0.91
46	0.88
47	0.86
48	0.85
49	0.85
50	0.84
51	0.81
52	0.77
53	0.71
54	0.68
55	0.67
56	0.62
57	0.52
58	0.44
59	0.38
60	0.36
61	0.33
62	0.3
63	0.23
64	0.19
65	0.18
66	0.17
67	0.14
68	0.1
69	0.06
70	0.05
71	0.05
72	0.05
73	0.04
74	0.04
75	0.05
76	0.06
77	0.07
78	0.14
79	0.16
80	0.19
81	0.22
82	0.23
83	0.24
84	0.24
85	0.24
86	0.2
87	0.18
88	0.18
89	0.19
90	0.19
91	0.24
92	0.23
93	0.22
94	0.21
95	0.22
96	0.21
97	0.18
98	0.19
99	0.11
100	0.13
101	0.13
102	0.12
103	0.11
104	0.09
105	0.08
106	0.08
107	0.08
108	0.09
109	0.1
110	0.11
111	0.11
112	0.12
113	0.12
114	0.13
115	0.13
116	0.1
117	0.09
118	0.09
119	0.09
120	0.08
121	0.08
122	0.07
123	0.06
124	0.07
125	0.08
126	0.08
127	0.07
128	0.07
129	0.08
130	0.08
131	0.07
132	0.06
133	0.08
134	0.08
135	0.08
136	0.08
137	0.07
138	0.09
139	0.1
140	0.11
141	0.1
142	0.12
143	0.14
144	0.16
145	0.17
146	0.14
147	0.15
148	0.15
149	0.14
150	0.13
151	0.11
152	0.11
153	0.09
154	0.09
155	0.08
156	0.09
157	0.09
158	0.09
159	0.08
160	0.07
161	0.07
162	0.07
163	0.07
164	0.06
165	0.06
166	0.05
167	0.05
168	0.06
169	0.06
170	0.07
171	0.06
172	0.06
173	0.09
174	0.1
175	0.1
176	0.09
177	0.08
178	0.07
179	0.07
180	0.07
181	0.04
182	0.04
183	0.03
184	0.03
185	0.03
186	0.03
187	0.03
188	0.03
189	0.03
190	0.02
191	0.02
192	0.02
193	0.02
194	0.02
195	0.03
196	0.02
197	0.02
198	0.03
199	0.03
200	0.04
201	0.04
202	0.04
203	0.04
204	0.04
205	0.08
206	0.08
207	0.11
208	0.13
209	0.15
210	0.15
211	0.15
212	0.15
213	0.12
214	0.13
215	0.11
216	0.09
217	0.09
218	0.09
219	0.11
220	0.11
221	0.11
222	0.1
223	0.09
224	0.08
225	0.07
226	0.06
227	0.04
228	0.04
229	0.04
230	0.03
231	0.03
232	0.04
233	0.03
234	0.03
235	0.03
236	0.06
237	0.09
238	0.11
239	0.12
240	0.17
241	0.2
242	0.25
243	0.33
244	0.41
245	0.45
246	0.47
247	0.49
248	0.47
249	0.45
250	0.41
251	0.35
252	0.25
253	0.18
254	0.15
255	0.13
256	0.1
257	0.09
258	0.08
259	0.08
260	0.07
261	0.07
262	0.07
263	0.08
264	0.07
265	0.08
266	0.08
267	0.09
268	0.09
269	0.1
270	0.09
271	0.09
272	0.09
273	0.09
274	0.1
275	0.1
276	0.11
277	0.11
278	0.11
279	0.11
280	0.13
281	0.14
282	0.13
283	0.13
284	0.12
285	0.13
286	0.14
287	0.18
288	0.17
289	0.16
290	0.2
291	0.2
292	0.2
293	0.22
294	0.21
295	0.19
296	0.2
297	0.19
298	0.15
299	0.14
300	0.13
301	0.12
302	0.11
303	0.11
304	0.09
305	0.09
306	0.09
307	0.09
308	0.1
309	0.09
310	0.1
311	0.1
312	0.15
313	0.16
314	0.15
315	0.15
316	0.14
317	0.13
318	0.11
319	0.12
320	0.06
321	0.05
322	0.06
323	0.06
324	0.06
325	0.06
326	0.06
327	0.06
328	0.06
329	0.07
330	0.07
331	0.08
332	0.08
333	0.08
334	0.09
335	0.1
336	0.12
337	0.16
338	0.17
339	0.17
340	0.18
341	0.18
342	0.18
343	0.19
344	0.25
345	0.27
346	0.31
347	0.38
348	0.41
349	0.47
350	0.49
351	0.47
352	0.42
353	0.37
354	0.35
355	0.3
356	0.28
357	0.22
358	0.19
359	0.19
360	0.16
361	0.13
362	0.13
363	0.1
364	0.16
365	0.16
366	0.17
367	0.18
368	0.18
369	0.18
370	0.23
371	0.32
372	0.3
373	0.4
374	0.48
375	0.53
376	0.54
377	0.56
378	0.52
379	0.45
380	0.42
381	0.32
382	0.23
383	0.17
384	0.16
385	0.13
386	0.11
387	0.09
388	0.08
389	0.09
390	0.09
391	0.1
392	0.13
393	0.17
394	0.19
395	0.22
396	0.25
397	0.33
398	0.4
399	0.44
400	0.45
401	0.42
402	0.41
403	0.41
404	0.39
405	0.37
406	0.3
407	0.25
408	0.21
409	0.19
410	0.18
411	0.16
412	0.16
413	0.09
414	0.13
415	0.13
416	0.18
417	0.19
418	0.2
419	0.2
420	0.21
421	0.27
422	0.28
423	0.34
424	0.37
425	0.42
426	0.42
427	0.43
428	0.46
429	0.45
430	0.43
431	0.4
432	0.38
433	0.35
434	0.34
435	0.33
436	0.3
437	0.28
438	0.31
439	0.34
440	0.34
441	0.33
442	0.31
443	0.31
444	0.32
445	0.31
446	0.26
447	0.22
448	0.24
449	0.22

A0A194XWV0

3D AlphaFold-predicted Structure Viewer