Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194WU41

Protein Details
Accession A0A194WU41    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
136-160LETAERQRRLLRRLKRKVNRVLSIVHydrophilic
NLS Segment(s)
PositionSequence
140-152ERQRRLLRRLKRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Gene Ontology GO:0006338  P:chromatin remodeling  
KEGG psco:LY89DRAFT_758900  -  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
Amino Acid Sequences MASSNIEDILSFASSDREDILSGTIDDSEDILSWAIDDSEDDLEDDTESLASLETDDGQDHPPEKVLAQTTSKNGFTWFLVKWRDCPVLRSSWEGESLFIRCPEIYESWKVERKRQAEGKSQPLEIEAFNKAVKKLETAERQRRLLRRLKRKVNRVLSIVTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.1
5 0.1
6 0.11
7 0.12
8 0.11
9 0.11
10 0.1
11 0.09
12 0.08
13 0.08
14 0.08
15 0.07
16 0.06
17 0.06
18 0.06
19 0.05
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.07
45 0.08
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.11
53 0.11
54 0.13
55 0.15
56 0.17
57 0.19
58 0.22
59 0.22
60 0.2
61 0.19
62 0.17
63 0.15
64 0.16
65 0.13
66 0.15
67 0.18
68 0.18
69 0.2
70 0.23
71 0.28
72 0.26
73 0.28
74 0.26
75 0.27
76 0.29
77 0.3
78 0.27
79 0.23
80 0.25
81 0.22
82 0.2
83 0.16
84 0.16
85 0.14
86 0.12
87 0.12
88 0.09
89 0.1
90 0.12
91 0.13
92 0.15
93 0.18
94 0.21
95 0.26
96 0.33
97 0.33
98 0.38
99 0.44
100 0.43
101 0.49
102 0.53
103 0.54
104 0.58
105 0.63
106 0.65
107 0.6
108 0.58
109 0.49
110 0.42
111 0.37
112 0.28
113 0.24
114 0.16
115 0.14
116 0.15
117 0.17
118 0.16
119 0.19
120 0.19
121 0.19
122 0.22
123 0.29
124 0.38
125 0.46
126 0.56
127 0.59
128 0.64
129 0.7
130 0.72
131 0.71
132 0.7
133 0.71
134 0.72
135 0.76
136 0.81
137 0.84
138 0.87
139 0.9
140 0.91
141 0.87
142 0.8