Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WEB7

Protein Details
Accession G0WEB7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-34LNQAYGPSSKKKSKKSNKKSTTSSTSSQHydrophilic
NLS Segment(s)
PositionSequence
16-25KKKSKKSNKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
KEGG ndi:NDAI_0G03510  -  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSLHSYLNQAYGPSSKKKSKKSNKKSTTSSTSSQDRNVFNVTESSHQILSNKKVSKAYRTSTVNGKGKLLWKNVDTNELVEIQDDKATRLIQTNDGESGNPRNVTRLESQETVFRDEKGHKLTRERNERRNKETSEDLREQLRKKRLQEINMGEVQLHWLKNGKSEDSTMKKKEMLKEEDPAMVFDVNEQEDNIPTSLLGRRLYDGKFPENRFHIVPGPRWDGVDRSNGFEKKWLLKKQEQENVITEQKFNEGDHDSDEYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.52
4 0.62
5 0.71
6 0.77
7 0.84
8 0.87
9 0.91
10 0.92
11 0.92
12 0.9
13 0.88
14 0.86
15 0.8
16 0.74
17 0.69
18 0.66
19 0.6
20 0.57
21 0.54
22 0.47
23 0.44
24 0.42
25 0.36
26 0.3
27 0.3
28 0.25
29 0.22
30 0.24
31 0.23
32 0.21
33 0.21
34 0.23
35 0.25
36 0.29
37 0.34
38 0.35
39 0.36
40 0.42
41 0.44
42 0.5
43 0.52
44 0.51
45 0.51
46 0.52
47 0.52
48 0.53
49 0.59
50 0.57
51 0.5
52 0.48
53 0.42
54 0.44
55 0.47
56 0.43
57 0.37
58 0.33
59 0.38
60 0.38
61 0.39
62 0.33
63 0.28
64 0.25
65 0.22
66 0.2
67 0.14
68 0.14
69 0.1
70 0.12
71 0.11
72 0.1
73 0.11
74 0.12
75 0.12
76 0.15
77 0.16
78 0.19
79 0.2
80 0.2
81 0.2
82 0.2
83 0.19
84 0.17
85 0.19
86 0.16
87 0.16
88 0.15
89 0.15
90 0.16
91 0.19
92 0.21
93 0.22
94 0.24
95 0.24
96 0.24
97 0.26
98 0.27
99 0.28
100 0.26
101 0.22
102 0.2
103 0.21
104 0.24
105 0.27
106 0.3
107 0.27
108 0.34
109 0.41
110 0.48
111 0.57
112 0.6
113 0.63
114 0.7
115 0.73
116 0.72
117 0.71
118 0.64
119 0.56
120 0.57
121 0.52
122 0.49
123 0.45
124 0.4
125 0.38
126 0.41
127 0.41
128 0.41
129 0.44
130 0.42
131 0.42
132 0.51
133 0.51
134 0.5
135 0.55
136 0.52
137 0.49
138 0.45
139 0.42
140 0.32
141 0.27
142 0.26
143 0.2
144 0.15
145 0.11
146 0.13
147 0.13
148 0.19
149 0.21
150 0.2
151 0.18
152 0.21
153 0.28
154 0.32
155 0.39
156 0.36
157 0.36
158 0.39
159 0.42
160 0.46
161 0.47
162 0.48
163 0.44
164 0.45
165 0.45
166 0.44
167 0.4
168 0.33
169 0.26
170 0.19
171 0.15
172 0.12
173 0.12
174 0.1
175 0.1
176 0.1
177 0.09
178 0.09
179 0.11
180 0.1
181 0.08
182 0.07
183 0.09
184 0.12
185 0.15
186 0.15
187 0.15
188 0.17
189 0.21
190 0.23
191 0.27
192 0.28
193 0.32
194 0.39
195 0.41
196 0.45
197 0.45
198 0.46
199 0.42
200 0.41
201 0.4
202 0.37
203 0.4
204 0.41
205 0.43
206 0.4
207 0.4
208 0.38
209 0.34
210 0.32
211 0.35
212 0.3
213 0.3
214 0.37
215 0.37
216 0.36
217 0.39
218 0.41
219 0.41
220 0.49
221 0.52
222 0.52
223 0.58
224 0.67
225 0.71
226 0.75
227 0.68
228 0.63
229 0.59
230 0.57
231 0.56
232 0.48
233 0.39
234 0.32
235 0.33
236 0.3
237 0.27
238 0.25
239 0.22
240 0.22
241 0.24