Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B6W2

Protein Details
Accession A0A132B6W2   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-70SNAGSNSSGRRRRRRKNKSALGQPLAHydrophilic
NLS Segment(s)
PositionSequence
53-62GRRRRRRKNK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
KEGG psco:LY89DRAFT_346144  -  
Amino Acid Sequences MASNTTNTKTAAPTPPFPSTNGAGPSKDSILNDLRRQLDDSDISSNAGSNSSGRRRRRRKNKSALGQPLAATGPTVIPRLAETKPVRLQLGLNLDVELELKARIQGDVSLTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.45
4 0.44
5 0.43
6 0.36
7 0.36
8 0.35
9 0.32
10 0.26
11 0.27
12 0.27
13 0.25
14 0.25
15 0.2
16 0.19
17 0.24
18 0.28
19 0.29
20 0.32
21 0.32
22 0.31
23 0.33
24 0.29
25 0.26
26 0.22
27 0.21
28 0.18
29 0.17
30 0.16
31 0.14
32 0.14
33 0.11
34 0.1
35 0.08
36 0.07
37 0.11
38 0.19
39 0.27
40 0.34
41 0.45
42 0.55
43 0.65
44 0.76
45 0.82
46 0.85
47 0.88
48 0.9
49 0.89
50 0.89
51 0.86
52 0.78
53 0.68
54 0.57
55 0.47
56 0.37
57 0.28
58 0.18
59 0.1
60 0.08
61 0.08
62 0.09
63 0.07
64 0.07
65 0.09
66 0.12
67 0.12
68 0.2
69 0.21
70 0.27
71 0.32
72 0.34
73 0.34
74 0.31
75 0.32
76 0.29
77 0.33
78 0.27
79 0.23
80 0.21
81 0.2
82 0.19
83 0.18
84 0.13
85 0.08
86 0.06
87 0.06
88 0.08
89 0.09
90 0.09
91 0.09
92 0.11
93 0.13