Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZT17

Protein Details
Accession E4ZT17    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-64FSILPLPSKKKNSKNSNKNRREHLSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
Amino Acid Sequences MTPSPPIRLKLHLHHLTTIPTPRLPTSAYPAPPENIHTFSILPLPSKKKNSKNSNKNRREHLSATSTSFLLLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.45
4 0.43
5 0.41
6 0.32
7 0.27
8 0.26
9 0.24
10 0.24
11 0.23
12 0.2
13 0.22
14 0.26
15 0.26
16 0.27
17 0.28
18 0.27
19 0.26
20 0.27
21 0.23
22 0.2
23 0.19
24 0.17
25 0.16
26 0.15
27 0.17
28 0.14
29 0.13
30 0.15
31 0.2
32 0.25
33 0.34
34 0.42
35 0.48
36 0.59
37 0.68
38 0.75
39 0.81
40 0.86
41 0.89
42 0.91
43 0.88
44 0.87
45 0.83
46 0.79
47 0.71
48 0.66
49 0.62
50 0.55
51 0.52
52 0.45
53 0.38
54 0.31