Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194X0N5

Protein Details
Accession A0A194X0N5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
222-244ILTLRRASHKKKLSKIRESMNMEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, E.R. 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_784631  -  
Amino Acid Sequences MGFFNEKRQSKVSVSPALSQEPLSASSRHSGFDPSLPALEKKDSKYKRSIRVLRFITRLLSVVLNALMIGVLSYALYKYFTTKSHPISSTNSSSPWVNPATLWPTFVLLGIALVTFVMNLFTLVAYCCGVGAANRVNTCSTVVSYIFLGVHVLLWALAAGAFKMGSNGKDLWGYSCSDQADKLQEEVKSFLDFGKLCTMQTGAWYVSIIETGVYLLTFVITILTLRRASHKKKLSKIRESMNMEAGYDKVELGSMYKQGRRYMPLAGESPSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.51
4 0.49
5 0.45
6 0.37
7 0.31
8 0.24
9 0.24
10 0.21
11 0.19
12 0.18
13 0.22
14 0.23
15 0.22
16 0.21
17 0.21
18 0.21
19 0.24
20 0.25
21 0.21
22 0.23
23 0.24
24 0.25
25 0.24
26 0.29
27 0.3
28 0.31
29 0.4
30 0.44
31 0.48
32 0.57
33 0.63
34 0.66
35 0.73
36 0.78
37 0.74
38 0.78
39 0.78
40 0.74
41 0.69
42 0.6
43 0.51
44 0.42
45 0.36
46 0.27
47 0.21
48 0.15
49 0.13
50 0.11
51 0.09
52 0.08
53 0.06
54 0.05
55 0.04
56 0.04
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.04
63 0.05
64 0.05
65 0.09
66 0.11
67 0.13
68 0.19
69 0.25
70 0.3
71 0.36
72 0.37
73 0.37
74 0.4
75 0.44
76 0.42
77 0.37
78 0.33
79 0.28
80 0.27
81 0.24
82 0.23
83 0.19
84 0.14
85 0.13
86 0.14
87 0.17
88 0.16
89 0.17
90 0.13
91 0.13
92 0.13
93 0.13
94 0.1
95 0.06
96 0.05
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.02
103 0.02
104 0.03
105 0.02
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.06
119 0.08
120 0.1
121 0.1
122 0.11
123 0.12
124 0.12
125 0.13
126 0.11
127 0.08
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.07
134 0.06
135 0.06
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.02
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.05
151 0.06
152 0.06
153 0.09
154 0.09
155 0.1
156 0.11
157 0.11
158 0.12
159 0.12
160 0.13
161 0.11
162 0.14
163 0.14
164 0.14
165 0.14
166 0.14
167 0.18
168 0.17
169 0.18
170 0.18
171 0.18
172 0.19
173 0.21
174 0.2
175 0.16
176 0.15
177 0.14
178 0.15
179 0.14
180 0.15
181 0.2
182 0.19
183 0.18
184 0.19
185 0.19
186 0.15
187 0.16
188 0.17
189 0.1
190 0.1
191 0.1
192 0.1
193 0.09
194 0.09
195 0.08
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.04
209 0.05
210 0.09
211 0.1
212 0.11
213 0.2
214 0.28
215 0.35
216 0.45
217 0.53
218 0.59
219 0.67
220 0.78
221 0.8
222 0.81
223 0.83
224 0.81
225 0.81
226 0.79
227 0.73
228 0.69
229 0.58
230 0.49
231 0.42
232 0.34
233 0.26
234 0.19
235 0.15
236 0.08
237 0.08
238 0.08
239 0.1
240 0.12
241 0.16
242 0.21
243 0.25
244 0.29
245 0.34
246 0.38
247 0.41
248 0.41
249 0.42
250 0.41
251 0.42
252 0.4
253 0.37