Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194X4I6

Protein Details
Accession A0A194X4I6   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAPQNNDKPKRRKKRKSRTEVSSDSDSHydrophilic
NLS Segment(s)
PositionSequence
8-18KPKRRKKRKSR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG psco:LY89DRAFT_735814  -  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAPQNNDKPKRRKKRKSRTEVSSDSDSETSPATEQPSKKFKSPPEPTTLSDAEVDKAFTKFYMQRLTTEFEDDLDKLRKADDFKDDALEILIGALQQGTSMFGMGEKRRIVEAGMGKKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.96
4 0.95
5 0.93
6 0.91
7 0.87
8 0.81
9 0.75
10 0.64
11 0.56
12 0.46
13 0.37
14 0.28
15 0.22
16 0.16
17 0.12
18 0.12
19 0.13
20 0.18
21 0.2
22 0.27
23 0.35
24 0.37
25 0.4
26 0.45
27 0.47
28 0.53
29 0.59
30 0.57
31 0.56
32 0.57
33 0.54
34 0.54
35 0.48
36 0.38
37 0.31
38 0.26
39 0.2
40 0.16
41 0.15
42 0.1
43 0.1
44 0.09
45 0.07
46 0.09
47 0.1
48 0.13
49 0.19
50 0.19
51 0.21
52 0.23
53 0.27
54 0.25
55 0.25
56 0.22
57 0.16
58 0.17
59 0.15
60 0.17
61 0.16
62 0.16
63 0.13
64 0.14
65 0.16
66 0.17
67 0.2
68 0.22
69 0.23
70 0.23
71 0.25
72 0.25
73 0.22
74 0.21
75 0.17
76 0.11
77 0.07
78 0.07
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.05
86 0.04
87 0.05
88 0.05
89 0.07
90 0.12
91 0.14
92 0.2
93 0.19
94 0.21
95 0.22
96 0.22
97 0.22
98 0.24
99 0.3
100 0.33